Clone GH04753 Report

Search the DGRC for GH04753

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:47
Well:53
Vector:pOT2
Associated Gene/TranscriptGstE12-RA
Protein status:GH04753.pep: gold
Preliminary Size:1100
Sequenced Size:928

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16936 2000-02-14 Blastp of sequenced clone
CG16936 2001-01-01 Release 2 assignment
CG16936 2003-01-01 Sim4 clustering to Release 3
CG16936 2008-04-29 Release 5.5 accounting
CG16936 2008-08-15 Release 5.9 accounting
CG16936 2008-12-18 5.12 accounting

Clone Sequence Records

GH04753.complete Sequence

928 bp (928 high quality bases) assembled on 2000-02-14

GenBank Submission: AF132151

> GH04753.complete
CGGAGAAGACGTTCGTGCGGCAGTTCTGTATTTACTTTTGTGGTCACAGA
GAAATATTCAACCATGTCAAAGCCAGCTCTGTATTATGCCACCCTAAGTC
CCCCATCGCGCGCCGTCCTCCTCACGGCTAAGGCGATCGGACTCGACCTT
GAACTACGGCCAATTAACCTGCTGAAGGGAGAGCATCTGACTCCGGAATT
CCTCAAGCTGAACCCCCAGCACACCATCCCGACCCTGATCGACGGCGAGG
CCACTATCATTGACTCGCACGCCATCTGCGCCTACCTGGTGGAGAAGTAT
GGCCAGAAGGAGCAGCAGCTCTATCCGAAGGAATTGGTGCAGCGCGCCAA
CGTGGATGCTCGGCTCCATCTGGACTCCGGCCACCTCTTCGCGCGCCTGC
GCTTCCTTTACGAGCCCATCCTGTATTATGGATCGACGGACTGCTCCATC
GACAAGATCGCATACATCCAGAAGTGCTGGGAGATCCTAGAGGGATTCCT
CAAGGATCAGCCGTATTTGTGTGGTTCTGATCTAACCATCGCAGACTTTT
GCGCCGTGGCCACCGTAACCTCGGTGAACGACACCGCTCCCATCGATGAA
TTTAAGTTTCCCAAGATGCACGCCTGGCTGAAGCGTCTGGCAGAGCTACC
CTACTACCAGGAGGTAAACGGCGACGGCGCTGACGAGCTTAAGAGCATCT
TCAAGGCCAAGCTGGCAGAAAACCGTGGCAAGTAGGCGGCGGCTCTATTA
TGTTTTGTTTTATATCCACACATTCTATATGCATATCCACTTTTGAATAA
ACGGATTAGATCAAAGTAAGATTTTAGCAGTTACAGCGACTTTGATCGAT
CCTTTATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH04753.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG16936-RA 1025 CG16936-RA 119..978 1..860 4300 100 Plus
CG16936.a 1139 CG16936.a 287..1092 55..860 4030 100 Plus
CG16936.a 1139 CG16936.a 89..143 1..55 275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20652656..20653356 858..158 3505 100 Minus
chr2R 21145070 chr2R 20653412..20653515 159..56 520 100 Minus
chr2R 21145070 chr2R 20654036..20654090 55..1 275 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24766716..24767418 860..158 3515 100 Minus
2R 25286936 2R 24767474..24767577 159..56 520 100 Minus
2R 25286936 2R 24768098..24768152 55..1 275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24767915..24768617 860..158 3515 100 Minus
2R 25260384 2R 24768673..24768776 159..56 520 100 Minus
2R 25260384 2R 24769297..24769351 55..1 275 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:08:10 has no hits.

GH04753.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:08:58 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20652656..20653355 159..858 100 <- Minus
chr2R 20653413..20653515 56..158 100 <- Minus
chr2R 20654036..20654090 1..55 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:15:22 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 1..672 64..735 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:33:16 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 1..672 64..735 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:46 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RD 1..672 64..735 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:07:46 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 1..672 64..735 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:20:29 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RD 1..672 64..735 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:35:23 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:33:15 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 23..880 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:46 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RA 23..880 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:07:46 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:20:29 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RA 21..878 1..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:58 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24766718..24767417 159..858 100 <- Minus
2R 24767475..24767577 56..158 100 <- Minus
2R 24768098..24768152 1..55 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:58 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24766718..24767417 159..858 100 <- Minus
2R 24767475..24767577 56..158 100 <- Minus
2R 24768098..24768152 1..55 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:08:58 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24766718..24767417 159..858 100 <- Minus
2R 24767475..24767577 56..158 100 <- Minus
2R 24768098..24768152 1..55 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:46 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20654241..20654940 159..858 100 <- Minus
arm_2R 20654998..20655100 56..158 100 <- Minus
arm_2R 20655621..20655675 1..55 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:45:19 Download gff for GH04753.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24769315..24769369 1..55 100   Minus
2R 24767935..24768634 159..858 100 <- Minus
2R 24768692..24768794 56..158 100 <- Minus

GH04753.hyp Sequence

Translation from 1 to 734

> GH04753.hyp
RRRRSCGSSVFTFVVTEKYSTMSKPALYYATLSPPSRAVLLTAKAIGLDL
ELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKY
GQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSI
DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDE
FKFPKMHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENRGK*

GH04753.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-PC 223 CG16936-PC 1..223 22..244 1169 100 Plus
GstE12-PB 223 CG16936-PB 1..223 22..244 1169 100 Plus
GstE12-PD 223 CG16936-PD 1..223 22..244 1169 100 Plus
GstE12-PA 223 CG16936-PA 1..223 22..244 1169 100 Plus
GstE11-PB 225 CG5224-PB 3..225 23..244 566 49.3 Plus

GH04753.pep Sequence

Translation from 63 to 734

> GH04753.pep
MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLN
PQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDAR
LHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKCWEILEGFLKDQP
YLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYYQE
VNGDGADELKSIFKAKLAENRGK*

GH04753.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13293-PA 223 GF13293-PA 1..223 1..223 1135 95.1 Plus
Dana\GF11968-PA 972 GF11968-PA 3..216 2..214 565 50.5 Plus
Dana\GF12169-PA 221 GF12169-PA 1..215 1..216 488 47.5 Plus
Dana\GF12173-PA 221 GF12173-PA 1..213 1..214 481 46 Plus
Dana\GF12168-PA 219 GF12168-PA 1..217 1..218 473 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19896-PA 223 GG19896-PA 1..223 1..223 1166 98.2 Plus
Dere\GG21901-PA 225 GG21901-PA 3..225 2..223 544 48.4 Plus
Dere\GG21886-PA 222 GG21886-PA 1..216 1..216 511 46.1 Plus
Dere\GG21885-PA 219 GG21885-PA 1..217 1..218 503 47.7 Plus
Dere\GG21891-PA 221 GG21891-PA 1..219 1..219 470 46.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21542-PA 224 GH21542-PA 1..222 1..222 1013 83.3 Plus
Dgri\GH19714-PA 221 GH19714-PA 3..221 2..220 597 51.6 Plus
Dgri\GH15974-PA 219 GH15974-PA 1..213 1..214 511 49.5 Plus
Dgri\GH21668-PA 217 GH21668-PA 1..216 1..217 494 48.2 Plus
Dgri\GH21671-PA 221 GH21671-PA 1..219 1..219 468 44.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-PC 223 CG16936-PC 1..223 1..223 1169 100 Plus
GstE12-PB 223 CG16936-PB 1..223 1..223 1169 100 Plus
GstE12-PD 223 CG16936-PD 1..223 1..223 1169 100 Plus
GstE12-PA 223 CG16936-PA 1..223 1..223 1169 100 Plus
GstE11-PB 225 CG5224-PB 3..225 2..223 566 49.3 Plus
GstE11-PA 225 CG5224-PA 3..225 2..223 566 49.3 Plus
GstE4-PA 222 CG17525-PA 1..216 1..216 489 45.6 Plus
GstE9-PA 221 CG17534-PA 1..219 1..219 467 45.5 Plus
GstE10-PB 240 CG17522-PB 1..224 1..223 458 43.6 Plus
GstE10-PA 240 CG17522-PA 1..224 1..223 458 43.6 Plus
GstE3-PA 220 CG17524-PA 1..215 1..216 453 43.5 Plus
GstE8-PB 222 CG17533-PB 1..214 1..214 447 45.1 Plus
GstE8-PA 222 CG17533-PA 1..214 1..214 447 45.1 Plus
GstE6-PA 222 CG17530-PA 1..214 1..214 446 44.2 Plus
GstE7-PA 223 CG17531-PA 1..214 1..214 442 45.6 Plus
GstE2-PA 221 CG17523-PA 4..217 3..217 439 44.7 Plus
GstE13-PB 226 CG11784-PB 1..224 1..223 436 39.1 Plus
GstE13-PA 226 CG11784-PA 1..224 1..223 436 39.1 Plus
GstE5-PA 222 CG17527-PA 1..215 1..215 428 42.1 Plus
GstE1-PA 224 CG5164-PA 8..217 6..216 424 42.7 Plus
GstD4-PA 215 CG11512-PA 4..212 7..218 359 36.8 Plus
GstD1-PB 209 CG10045-PB 5..209 7..214 358 39.9 Plus
GstD1-PA 209 CG10045-PA 5..209 7..214 358 39.9 Plus
GstD5-PA 216 CG12242-PA 4..212 7..218 352 38.7 Plus
GstD11-PA 222 CG17639-PA 1..222 1..222 345 36.4 Plus
GstD7-PA 224 CG4371-PA 6..212 6..214 345 37.4 Plus
GstD11-PB 243 CG17639-PB 22..243 1..222 345 36.4 Plus
GstD8-PA 212 CG4421-PA 4..210 7..216 335 37.4 Plus
GstD9-PB 218 CG10091-PB 5..210 7..213 335 37.5 Plus
GstD9-PA 218 CG10091-PA 5..210 7..213 335 37.5 Plus
GstD2-PA 215 CG4181-PA 4..210 7..216 334 36.2 Plus
GstD6-PA 215 CG4423-PA 3..210 6..220 333 37.3 Plus
GstD10-PB 210 CG18548-PB 3..208 6..213 324 37.3 Plus
GstD10-PA 210 CG18548-PA 3..208 6..213 324 37.3 Plus
GstE14-PA 232 CG4688-PA 5..214 3..215 314 34.3 Plus
GstD3-PA 199 CG4381-PA 1..194 20..216 311 35.5 Plus
gfzf-PD 234 CG33546-PD 3..208 6..211 215 30.3 Plus
gfzf-PE 1045 CG33546-PE 814..1019 6..211 215 30.3 Plus
gfzf-PB 1045 CG33546-PB 814..1019 6..211 215 30.3 Plus
GstT2-PA 228 CG30005-PA 1..211 1..200 208 32.7 Plus
GstT1-PA 228 CG30000-PA 8..227 7..216 198 29.9 Plus
GstT3-PC 228 CG1702-PC 1..209 1..198 191 32.9 Plus
GstT3-PA 228 CG1702-PA 1..209 1..198 191 32.9 Plus
GstT3-PB 268 CG1702-PB 41..249 1..198 191 32.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19515-PA 223 GI19515-PA 1..223 1..223 1028 83.4 Plus
Dmoj\GI20133-PA 225 GI20133-PA 6..225 1..220 612 52.3 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..213 1..214 507 50 Plus
Dmoj\GI20121-PA 222 GI20121-PA 1..216 1..216 500 47.9 Plus
Dmoj\GI16623-PA 219 GI16623-PA 1..214 1..215 495 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17702-PA 223 GL17702-PA 1..223 1..223 1103 91.5 Plus
Dper\GL17783-PA 226 GL17783-PA 4..224 3..223 616 51.1 Plus
Dper\GL17770-PA 222 GL17770-PA 1..217 1..216 471 44.7 Plus
Dper\GL17771-PA 221 GL17771-PA 1..215 1..216 463 45.2 Plus
Dper\GL17773-PA 222 GL17773-PA 1..214 1..214 463 45.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14226-PA 223 GA14226-PA 1..223 1..223 1125 92.8 Plus
Dpse\GA18748-PA 226 GA18748-PA 4..224 3..223 617 51.6 Plus
Dpse\GA14541-PA 222 GA14541-PA 1..217 1..216 474 44.7 Plus
Dpse\GA14545-PA 222 GA14545-PA 1..214 1..214 469 46.5 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..215 1..216 465 45.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11796-PA 223 GM11796-PA 1..223 1..223 1172 98.7 Plus
Dsec\GM21891-PA 225 GM21891-PA 3..225 2..223 565 49.3 Plus
Dsec\GM21879-PA 222 GM21879-PA 1..216 1..216 502 45.6 Plus
Dsec\GM21878-PA 219 GM21878-PA 1..216 1..217 491 46.5 Plus
Dsec\GM21875-PA 221 GM21875-PA 4..217 3..217 465 47 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24922-PA 213 GD24922-PA 1..213 1..223 1061 91.5 Plus
Dsim\GD11373-PA 222 GD11373-PA 1..216 1..216 500 45.6 Plus
Dsim\GD11388-PA 251 GD11388-PA 48..251 21..223 493 46.6 Plus
Dsim\GD11372-PA 219 GD11372-PA 1..216 1..217 488 46.5 Plus
Dsim\GD25394-PA 240 GD25394-PA 6..224 6..223 464 44.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21084-PA 223 GJ21084-PA 1..223 1..223 1052 87 Plus
Dvir\GJ19903-PA 228 GJ19903-PA 9..228 3..222 604 51.4 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..213 1..214 514 50.5 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 1..219 1..219 481 45 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 1..216 1..216 479 46.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21654-PA 223 GK21654-PA 1..223 1..223 1029 85.2 Plus
Dwil\GK23004-PA 226 GK23004-PA 4..223 3..221 601 53.6 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..216 1..216 519 47 Plus
Dwil\GK22985-PA 219 GK22985-PA 1..217 1..218 461 45.4 Plus
Dwil\GK22984-PA 220 GK22984-PA 1..215 1..216 453 44 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11420-PA 223 GE11420-PA 1..223 1..223 1158 97.3 Plus
Dyak\GE11975-PA 225 GE11975-PA 3..225 2..223 572 50.7 Plus
Dyak\GE11961-PA 222 GE11961-PA 1..216 1..216 508 45.6 Plus
Dyak\GE11960-PA 219 GE11960-PA 1..217 1..218 489 47.2 Plus
Dyak\GE11964-PA 222 GE11964-PA 1..215 1..216 474 47.9 Plus