GH04760.complete Sequence
377 bp (377 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118738
> GH04760.complete
TCAATCATCTACAAAATCAAAATGCGTGTAATCTTCCTCATCGTTGTGCT
CGCCATGGTGGCTCTGGCTGCTGTCCAAGGACGTCGTCCTCCAGGACTTC
CGCAGGGAGGTCTGGGACCACTTCAGGGCTCTGGAGGACTCCAGCCGCCG
CAGGGAATACCTCAGGGACCTCCCCAGGGACTCCCACAAGGACCTCCCCA
AGGTGGCAACTCATCCTCCTCCGAAGACTCTTCCTCCCAGGAGAGCTCCA
GCGAGTCCTCCAGTGAGGCGTCCGCCTAGAAACTCGATCGCCGAGTCCTT
CATGTAAAAACATTCAAAAATCTTTAAATAAAGATATATATTCTGCTTAT
TTCAATATAAAAAAAAAAAAAAAAAAA
GH04760.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:55:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG1678-RA | 366 | CG1678-RA | 1..364 | 1..364 | 1805 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:39:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 21267539..21267896 | 358..1 | 1790 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 21402375..21402738 | 364..1 | 1805 | 99.7 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 21387467..21387830 | 364..1 | 1805 | 99.7 | Minus |
Blast to na_te.dros performed on 2019-03-16 09:39:11 has no hits.
GH04760.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed on 2019-03-16 09:39:54 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:15:26 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..258 | 22..279 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:49 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..258 | 22..279 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:57 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..258 | 22..279 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:14 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..258 | 22..279 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:56 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..258 | 22..279 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:47 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..358 | 1..358 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:49 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..358 | 1..358 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:57 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..358 | 1..358 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:14 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 1..358 | 1..358 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:56 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG1678-RA | 35..392 | 1..358 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:54 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 21402381..21402738 | 1..358 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:54 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 21402381..21402738 | 1..358 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:54 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 21402381..21402738 | 1..358 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:57 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 21273408..21273765 | 1..358 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:24 Download gff for
GH04760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 21387473..21387830 | 1..358 | 100 | | Minus |
GH04760.hyp Sequence
Translation from 1 to 278
> GH04760.hyp
SIIYKIKMRVIFLIVVLAMVALAAVQGRRPPGLPQGGLGPLQGSGGLQPP
QGIPQGPPQGLPQGPPQGGNSSSSEDSSSQESSSESSSEASA*
GH04760.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG1678-PB | 85 | CG1678-PB | 1..85 | 8..92 | 429 | 100 | Plus |
CG1678-PA | 85 | CG1678-PA | 1..85 | 8..92 | 429 | 100 | Plus |
CG13947-PA | 119 | CG13947-PA | 1..113 | 8..91 | 138 | 38.6 | Plus |
GH04760.pep Sequence
Translation from 21 to 278
> GH04760.pep
MRVIFLIVVLAMVALAAVQGRRPPGLPQGGLGPLQGSGGLQPPQGIPQGP
PQGLPQGPPQGGNSSSSEDSSSQESSSESSSEASA*
GH04760.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
whe-PB | 85 | CG1678-PB | 1..85 | 1..85 | 429 | 100 | Plus |
whe-PA | 85 | CG1678-PA | 1..85 | 1..85 | 429 | 100 | Plus |
CG13947-PA | 119 | CG13947-PA | 1..113 | 1..84 | 138 | 38.6 | Plus |