Clone GH04760 Report

Search the DGRC for GH04760

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:47
Well:60
Vector:pOT2
Associated Gene/TranscriptCG1678-RA
Protein status:GH04760.pep: gold
Preliminary Size:364
Sequenced Size:377

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1678 2002-01-01 Sim4 clustering to Release 2
CG1678 2002-05-18 Blastp of sequenced clone
CG1678 2003-01-01 Sim4 clustering to Release 3
CG1678 2008-04-29 Release 5.5 accounting
CG1678 2008-08-15 Release 5.9 accounting
CG1678 2008-12-18 5.12 accounting

Clone Sequence Records

GH04760.complete Sequence

377 bp (377 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118738

> GH04760.complete
TCAATCATCTACAAAATCAAAATGCGTGTAATCTTCCTCATCGTTGTGCT
CGCCATGGTGGCTCTGGCTGCTGTCCAAGGACGTCGTCCTCCAGGACTTC
CGCAGGGAGGTCTGGGACCACTTCAGGGCTCTGGAGGACTCCAGCCGCCG
CAGGGAATACCTCAGGGACCTCCCCAGGGACTCCCACAAGGACCTCCCCA
AGGTGGCAACTCATCCTCCTCCGAAGACTCTTCCTCCCAGGAGAGCTCCA
GCGAGTCCTCCAGTGAGGCGTCCGCCTAGAAACTCGATCGCCGAGTCCTT
CATGTAAAAACATTCAAAAATCTTTAAATAAAGATATATATTCTGCTTAT
TTCAATATAAAAAAAAAAAAAAAAAAA

GH04760.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG1678-RA 366 CG1678-RA 1..364 1..364 1805 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21267539..21267896 358..1 1790 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21402375..21402738 364..1 1805 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21387467..21387830 364..1 1805 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 09:39:11 has no hits.

GH04760.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed on 2019-03-16 09:39:54 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:15:26 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..258 22..279 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:49 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..258 22..279 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:57 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..258 22..279 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:14 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..258 22..279 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:56 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..258 22..279 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:47 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..358 1..358 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:49 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..358 1..358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:57 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..358 1..358 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:14 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 1..358 1..358 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:56 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
CG1678-RA 35..392 1..358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:54 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
X 21402381..21402738 1..358 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:54 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
X 21402381..21402738 1..358 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:54 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
X 21402381..21402738 1..358 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:57 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21273408..21273765 1..358 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:24 Download gff for GH04760.complete
Subject Subject Range Query Range Percent Splice Strand
X 21387473..21387830 1..358 100   Minus

GH04760.hyp Sequence

Translation from 1 to 278

> GH04760.hyp
SIIYKIKMRVIFLIVVLAMVALAAVQGRRPPGLPQGGLGPLQGSGGLQPP
QGIPQGPPQGLPQGPPQGGNSSSSEDSSSQESSSESSSEASA*

GH04760.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG1678-PB 85 CG1678-PB 1..85 8..92 429 100 Plus
CG1678-PA 85 CG1678-PA 1..85 8..92 429 100 Plus
CG13947-PA 119 CG13947-PA 1..113 8..91 138 38.6 Plus

GH04760.pep Sequence

Translation from 21 to 278

> GH04760.pep
MRVIFLIVVLAMVALAAVQGRRPPGLPQGGLGPLQGSGGLQPPQGIPQGP
PQGLPQGPPQGGNSSSSEDSSSQESSSESSSEASA*

GH04760.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
whe-PB 85 CG1678-PB 1..85 1..85 429 100 Plus
whe-PA 85 CG1678-PA 1..85 1..85 429 100 Plus
CG13947-PA 119 CG13947-PA 1..113 1..84 138 38.6 Plus