Clone GH04831 Report

Search the DGRC for GH04831

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:48
Well:31
Vector:pOT2
Associated Gene/TranscriptCG9804-RA
Protein status:GH04831.pep: gold
Preliminary Size:1270
Sequenced Size:1126

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9804 2001-01-01 Release 2 assignment
CG9804 2002-03-19 Blastp of sequenced clone
CG9804 2003-01-01 Sim4 clustering to Release 3
CG9804 2008-04-29 Release 5.5 accounting
CG9804 2008-08-15 Release 5.9 accounting
CG9804 2008-12-18 5.12 accounting

Clone Sequence Records

GH04831.complete Sequence

1126 bp (1126 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094675

> GH04831.complete
CGAAAGATTTCCCTCCAACGTATTTTCCGAATTGTTGTTAAACTGTTGGA
TTATTAATCGAAGTTTCCTCAAATAAAAAAACAAATTTCGCCAACTTTTC
CATTGCCACCAATCAGCCGTTTTTGAAGATACATATATTGATGAACCCGC
TGATCGTGCAGCCCTGGTTAATATTTGTTGTTTTAAACGTTGCAGTCAAA
TGATTTTTAAACAATTAAAAAAATGCCTTTTGTCCGACCGCTGGTGACCG
TGGTGCGGGCCGGGCGGCATAGCTATTCAGCAGGATTACAGCTACAGCAA
CGTCTTGCAAGGTCCAACCAGATCCTGAATCCGCCAGCGGAGTTCCGAAA
CTACCTGGTGCTTCAGGAGCACGACCCGGTCTACACAGTCGGACTAAGGA
CAAAGGACTATACGGCGCAGGATGAAGACCGACTCCGCCGGCTAGGAGCA
GACTTCCATCGCACAGATCGCGGTGGCTTGATCACATTTCACGGCCCCGG
CCAGTTGGTGGCCTATCCCATTCTGCACCTGGGTCAGTTCGTGCCGAGCA
TCCGCTGGTACGTGGCGACGTTGGAGCGGATGGTTGTCGAGGCCTGCCAC
CAGATGGGCATTTCCAGTGCCAAGGCGACCAAGGACACCGGTATCTGGGT
GGGTGACAACAAGATCTGTGCCATCGGTATCCACGGCTCGCGTTACGTCA
CCACGCATGGAATCGGCCTCAATTGCTGCACGGATCTGCAGTGGTTTGAG
CACATTGTGCCCTGCGGAATCGAAGGCAAGGGGGTCACCTCGCTCAGCAA
AGAGCTGGACAGACATTTTCCTGTCGAGGAGGCCAGTGGCGCACTCCTCA
ATAGTTTCGCTAAAGTTTTCGAATGCCGCCTTCAGGAACACGCCAAAAAA
CCAGCAAGTTCTGCTGAAATCGGATAATATGGTTATTTGGATACATATGA
TGTATAAAGGACCGCCAAGTTTATTTCAACATTTATAATTTAAATTATGC
ATCAATACATATTTCCTGGCCTTCTGTTATCTCAACTTTTACGAAATGGA
AATTTGTAAACTAGATTTATGTATTTCATAAAATATTAAAATAACATTAT
AACTATATAAAAAAAAAAAAAAAAAA

GH04831.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG9804-RA 1108 CG9804-RA 1..1108 1..1108 5540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 261941..263048 1108..1 5540 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4436221..4437329 1109..1 5545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4177052..4178160 1109..1 5545 100 Minus
Blast to na_te.dros performed 2019-03-15 18:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 1380..1483 1094..994 117 58.7 Minus

GH04831.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:02:49 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 261941..263048 1..1108 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:15:53 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..705 223..927 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:46 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..705 223..927 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:53:23 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..705 223..927 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:53 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..705 223..927 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:19 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..705 223..927 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:45 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..1108 1..1108 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:46 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..1108 1..1108 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:53:23 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..1108 1..1108 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:53 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..1108 1..1108 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:19 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
CG9804-RA 1..1108 1..1108 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:49 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4436222..4437329 1..1108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:49 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4436222..4437329 1..1108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:49 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4436222..4437329 1..1108 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:53:23 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 261944..263051 1..1108 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:39 Download gff for GH04831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4177053..4178160 1..1108 100   Minus

GH04831.hyp Sequence

Translation from 222 to 926

> GH04831.hyp
MPFVRPLVTVVRAGRHSYSAGLQLQQRLARSNQILNPPAEFRNYLVLQEH
DPVYTVGLRTKDYTAQDEDRLRRLGADFHRTDRGGLITFHGPGQLVAYPI
LHLGQFVPSIRWYVATLERMVVEACHQMGISSAKATKDTGIWVGDNKICA
IGIHGSRYVTTHGIGLNCCTDLQWFEHIVPCGIEGKGVTSLSKELDRHFP
VEEASGALLNSFAKVFECRLQEHAKKPASSAEIG*

GH04831.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG9804-PB 234 CG9804-PB 1..234 1..234 1243 100 Plus
CG9804-PA 234 CG9804-PA 1..234 1..234 1243 100 Plus

GH04831.pep Sequence

Translation from 222 to 926

> GH04831.pep
MPFVRPLVTVVRAGRHSYSAGLQLQQRLARSNQILNPPAEFRNYLVLQEH
DPVYTVGLRTKDYTAQDEDRLRRLGADFHRTDRGGLITFHGPGQLVAYPI
LHLGQFVPSIRWYVATLERMVVEACHQMGISSAKATKDTGIWVGDNKICA
IGIHGSRYVTTHGIGLNCCTDLQWFEHIVPCGIEGKGVTSLSKELDRHFP
VEEASGALLNSFAKVFECRLQEHAKKPASSAEIG*

GH04831.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16807-PA 232 GF16807-PA 1..224 1..224 940 76.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11554-PA 234 GG11554-PA 1..234 1..234 1129 89.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11741-PA 228 GH11741-PA 1..223 1..225 930 74.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9804-PB 234 CG9804-PB 1..234 1..234 1243 100 Plus
CG9804-PA 234 CG9804-PA 1..234 1..234 1243 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22071-PA 228 GI22071-PA 1..216 1..218 887 72.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22349-PA 232 GL22349-PA 1..228 1..228 943 75 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22047-PA 232 GA22047-PA 1..228 1..228 942 75 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19677-PA 234 GD19677-PA 1..234 1..234 1204 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10728-PA 228 GJ10728-PA 1..222 1..224 909 72.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13752-PA 230 GK13752-PA 1..223 1..223 884 71.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25349-PA 234 GE25349-PA 1..234 1..234 1128 88.9 Plus