Clone GH04870 Report

Search the DGRC for GH04870

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:48
Well:70
Vector:pOT2
Associated Gene/TranscriptCG18004-RC
Protein status:GH04870.pep: wuzgold
Preliminary Size:1259
Sequenced Size:1070

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18004 2001-01-01 Release 2 assignment
CG18004 2002-06-07 Blastp of sequenced clone
CG18004 2003-01-01 Sim4 clustering to Release 3
CG18004 2008-04-29 Release 5.5 accounting
CG18004 2008-08-15 Release 5.9 accounting
CG18004 2008-12-18 5.12 accounting

Clone Sequence Records

GH04870.complete Sequence

1070 bp (1070 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119470

> GH04870.complete
CCCTGGCCAACCAGGAGGATGGCGCCATAAAGGACGAGCCGCCGAGCGAC
GACGAGCCCGCACAGCCCGCCAGAGATCGCGTCCCGCCAATTTCCCGCGG
AGCAGCGCCCGCTAGCTCATCCTCCGTATCCGCGGGCCTGGGCGCAGGCG
AGACTGACTTCAAGGAGCGCTACAAGAACCTCAAGAAGAAGCTGAAGTTC
CTCATCTATGTAAATATCTAAAGTTGAACTTGGCCAATGGCAAGTCACAG
CTTTTTGTGTTTACAGGAGAACGAGTACTTCCAGGATCTATTGCACACCA
ACCAGCGGCGTCTGCTGAAAGTTTCCCGGGATCGTACCTTCCTGCTGGAC
CGTCTGCTGGTGTACGAGAAGCCGGCCAAGGACTCTAGCGACTCGGATGC
CACCGACAGCTCCGATTCGGAGCCAGCTTCTACGTCCGGCGTTGCCGGCG
GATCGCAAACATCCAAGGACGCCATTCGGCGCAAGCACAAAGACAAGGGG
GCACCAGGAATTCCAGGTGTGCCTCCGCACATGCCCACAGTGGGCGCCCC
ACGAGGTCGAAGACGAAAAATCCTAACCGGAATGTTGCCCGCGAACCATG
GAATCCCAGCAATTGCTGCGAAAAAACAACTTACCGCCACGGTGTCACCT
TCGCAGCAGCCACCGCAACTACAGACTGCTCCGAAGGATGTGTCGCCCGG
CCTCAGCCAAGCGGAGATTGCCCGCCAGCTGCAGGAGCGACGACCGACGC
CGTTGGAGCTATTGAGTCCGGAATGCACTTCGGCCACCGTGCCCACAACG
ATGCTCAGCGATGAAAGCCCCTCTAAGTGGTAATAAGTTGTGCAATTCCC
ACGTTGCAGCACCAATCTAATAATCGTGTTCTCTTAGTTATCCCAATGAA
AGCCTGCAGCATCTGATGGAGGACGACTCTCACTCGCACGAGGTGGCCGC
CGAGGAGTGCGTGCCCATGGAGTACACAAGTTAATATTCTTTACTGAGCT
AAATATGAAAATACGAAAATAAATTAACTAGATCCAGCTGGATTGATATA
TTAAAAAAAAAAAAAAAAAA

GH04870.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18004-RC 1052 CG18004-RC 1..1052 1..1052 5260 100 Plus
CG18004-RA 1250 CG18004-RA 414..976 267..829 2815 100 Plus
CG18004-RB 1168 CG18004-RB 441..1003 267..829 2815 100 Plus
CG18004-RA 1250 CG18004-RA 205..414 1..210 1050 100 Plus
CG18004-RB 1168 CG18004-RB 232..441 1..210 1050 100 Plus
CG18004-RA 1250 CG18004-RA 976..1142 887..1053 835 100 Plus
CG18004-RB 1168 CG18004-RB 1003..1168 887..1052 830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6772915..6773966 1..1052 5260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10885324..10886376 1..1053 5265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10886523..10887575 1..1053 5265 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:45:07 has no hits.

GH04870.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:46:04 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6772915..6773966 1..1052 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:16:13 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RC 1..597 237..833 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:27:39 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RC 1..597 237..833 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:45:05 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RB 8..216 1..209 100 == Plus
CG18004-RB 217..782 267..832 99 == Plus
CG18004-RB 783..876 891..984 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:18:11 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RC 1..597 237..833 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:16 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RB 8..216 1..209 100 == Plus
CG18004-RB 217..782 267..832 99 == Plus
CG18004-RB 783..876 891..984 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:56:23 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RC 1..1052 1..1052 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:27:39 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RC 1..1052 1..1052 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:45:05 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RB 232..440 1..209 100 == Plus
CG18004-RB 441..1006 267..832 99 == Plus
CG18004-RB 1007..1168 891..1052 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:18:11 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RC 1..1052 1..1052 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:16 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
CG18004-RB 232..440 1..209 100 == Plus
CG18004-RB 441..1006 267..832 99 == Plus
CG18004-RB 1007..1168 891..1052 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:46:04 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10885324..10886375 1..1052 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:46:04 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10885324..10886375 1..1052 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:46:04 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10885324..10886375 1..1052 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:45:05 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6772829..6773880 1..1052 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:51:30 Download gff for GH04870.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10886523..10887574 1..1052 100   Plus

GH04870.hyp Sequence

Translation from 236 to 832

> GH04870.hyp
MASHSFLCLQENEYFQDLLHTNQRRLLKVSRDRTFLLDRLLVYEKPAKDS
SDSDATDSSDSEPASTSGVAGGSQTSKDAIRRKHKDKGAPGIPGVPPHMP
TVGAPRGRRRKILTGMLPANHGIPAIAAKKQLTATVSPSQQPPQLQTAPK
DVSPGLSQAEIARQLQERRPTPLELLSPECTSATVPTTMLSDESPSKW*

GH04870.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG18004-PB 291 CG18004-PB 71..259 9..197 956 98.9 Plus
CG18004-PA 297 CG18004-PA 77..265 9..197 956 98.9 Plus
CG18004-PD 291 CG18004-PD 79..259 17..197 921 100 Plus

GH04870.pep Sequence

Translation from 236 to 832

> GH04870.pep
MASHSFLCLQENEYFQDLLHTNQRRLLKVSRDRTFLLDRLLVYEKPAKDS
SDSDATDSSDSEPASTSGVAGGSQTSKDAIRRKHKDKGAPGIPGVPPHMP
TVGAPRGRRRKILTGMLPANHGIPAIAAKKQLTATVSPSQQPPQLQTAPK
DVSPGLSQAEIARQLQERRPTPLELLSPECTSATVPTTMLSDESPSKW*

GH04870.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13783-PA 299 GF13783-PA 78..267 9..197 722 83.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20156-PA 297 GG20156-PA 77..265 9..197 836 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20557-PA 313 GH20557-PA 79..282 6..197 412 55.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG18004-PB 291 CG18004-PB 71..259 9..197 956 98.9 Plus
CG18004-PA 297 CG18004-PA 77..265 9..197 956 98.9 Plus
CG18004-PD 291 CG18004-PD 79..259 17..197 921 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18826-PA 305 GI18826-PA 81..274 7..197 472 62.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20093-PA 295 GL20093-PA 77..263 6..197 668 74 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24928-PA 295 GA24928-PA 77..263 6..197 665 74 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21245-PA 297 GM21245-PA 75..265 7..197 944 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10763-PA 252 GD10763-PA 75..220 6..197 648 71.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21854-PA 298 GJ21854-PA 76..267 7..197 465 63.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20638-PA 326 GK20638-PA 88..298 9..197 442 52.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12846-PA 297 GE12846-PA 77..265 9..197 823 92.1 Plus