Clone GH04877 Report

Search the DGRC for GH04877

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:48
Well:77
Vector:pOT2
Associated Gene/Transcriptrtp-RA
Protein status:GH04877.pep: gold
Preliminary Size:1300
Sequenced Size:943

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10233 2001-01-01 Release 2 assignment
CG10233 2001-10-10 Blastp of sequenced clone
CG10233 2003-01-01 Sim4 clustering to Release 3
CG10233 2008-04-29 Release 5.5 accounting
CG10233 2008-08-15 Release 5.9 accounting
CG10233 2008-12-18 5.12 accounting

Clone Sequence Records

GH04877.complete Sequence

943 bp (943 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060630

> GH04877.complete
CGGTAGCGGAGCAATGGCCATGGACGACTACGATGATGACATGAGCAGCG
TGGGCGTGACCACGGCCCGAATCGAGAACCAGCACCAACAGCACCCCCAC
CAGCAGGGTCAGCATGGACACCACCAACAGGGCCAGGGTCAAAGCCAGTA
CAGCGCAGGGGCGGTCAAAGTGGGCGGATGGCGATACGAGGACGCCAGTC
GCTACATCGGCGAGTGGAACCAGCGTGGCCAAAAGCACGGCATCGGGCAT
CTGCAGTTCGCCGATGGCACCCGCTACGATGGGCAGTTCCAGGAGGGTCT
TAGTCAAGGAGTGGGCTGCCTCTGGTTCGCGGATGGAGCAAAATACGAAG
GCGAGTTTCATCAGGGCTGGTTTCATGGTAATGGGATCTTCTGGAGAGCC
GATGGAATGAAGTACGAGGGCGAGTTTCGAGGCGGCAAGATCTGGGGCCT
GGGATTGCTGACGTTCCAGGACTTCACGCACGGCTTTCCCAGAAACGAGG
GATTCTTTCAAGACTGCCGCTTTATGAGACGACGTCGATGTCCCGAGGTG
GTGCAGCGTGCACAAAAGTGCGCTCTTATGGCCCGTTCCCAGTGCGAACA
CCCATACTGAACAGACACTTCAGATTGGTTACCGGTTGGTATTGATAAAC
ACGTACAGTTTAAAAATACAAATTTTGGTAACCGACTGTAAGAGTCTCAA
GTCATAAAACAGAAAAAGGTGCCTTTAAGAAAAGAAATAAGCATTTCTTT
CTTAACATCTTAAACTTTAATACATTTGCGCATAAACGTTCGTAAATGTG
TCTAAGTAATATAAAATGCATACAATTTCGCGTTTACTTTATAATTTTGC
TTTTTCCAAATTCTTTATCAAAAATTCTTCAACGCACCCTAATAAAAACA
ACAAGAAAATTATGAAGAAAAAAAAAAAAAAAAAAAAAAAAAA

GH04877.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
retinophilin-RA 1108 retinophilin-RA 117..1035 1..919 4550 99.6 Plus
retinophilin.a 455 retinophilin.a 45..455 1..407 1970 99 Plus
retinophilin-RB 509 retinophilin-RB 45..386 1..342 1710 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1061756..1062330 917..343 2830 99.5 Minus
chr3R 27901430 chr3R 1062537..1062837 342..42 1505 100 Minus
chr3R 27901430 chr3R 1062896..1062936 41..1 205 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5236090..5236666 919..343 2840 99.5 Minus
3R 32079331 3R 5236873..5237173 342..42 1505 100 Minus
3R 32079331 3R 5237232..5237272 41..1 205 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4976921..4977497 919..343 2840 99.4 Minus
3R 31820162 3R 4977704..4978004 342..42 1505 100 Minus
3R 31820162 3R 4978063..4978103 41..1 205 100 Minus
Blast to na_te.dros performed 2019-03-15 19:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 6596..6656 857..915 129 70.5 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 1129..1181 865..916 109 69.8 Plus

GH04877.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:09:30 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1061756..1062330 343..917 99 <- Minus
chr3R 1062537..1062837 42..342 100 <- Minus
chr3R 1062896..1062936 1..41 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:16:16 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
retinophilin-RA 1..597 14..610 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:37:54 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
rtp-RA 1..597 14..610 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:43:30 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
rtp-RA 1..597 14..610 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:06:52 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
retinophilin-RA 1..597 14..610 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:31 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
rtp-RA 1..597 14..610 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:18:50 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
retinophilin-RA 45..961 1..917 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:37:54 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
rtp-RA 44..960 1..917 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:43:30 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
rtp-RA 44..960 1..917 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:06:52 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
retinophilin-RA 45..961 1..917 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:31 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
rtp-RA 44..960 1..917 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:30 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5236092..5236666 343..917 99 <- Minus
3R 5236873..5237173 42..342 100 <- Minus
3R 5237232..5237272 1..41 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:30 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5236092..5236666 343..917 99 <- Minus
3R 5236873..5237173 42..342 100 <- Minus
3R 5237232..5237272 1..41 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:09:30 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5236092..5236666 343..917 99 <- Minus
3R 5236873..5237173 42..342 100 <- Minus
3R 5237232..5237272 1..41 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:43:30 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1061814..1062388 343..917 99 <- Minus
arm_3R 1062595..1062895 42..342 100 <- Minus
arm_3R 1062954..1062994 1..41 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:42:51 Download gff for GH04877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4976923..4977497 343..917 99 <- Minus
3R 4977704..4978004 42..342 100 <- Minus
3R 4978063..4978103 1..41 100   Minus

GH04877.hyp Sequence

Translation from 1 to 609

> GH04877.hyp
GSGAMAMDDYDDDMSSVGVTTARIENQHQQHPHQQGQHGHHQQGQGQSQY
SAGAVKVGGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGL
SQGVGCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGL
GLLTFQDFTHGFPRNEGFFQDCRFMRRRRCPEVVQRAQKCALMARSQCEH
PY*

GH04877.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
rtp-PA 198 CG10233-PA 1..198 5..202 1127 100 Plus
CG14490-PA 197 CG14490-PA 15..170 29..162 161 32.5 Plus
CG5458-PA 344 CG5458-PA 33..143 51..161 159 33 Plus
CG5458-PA 344 CG5458-PA 27..110 68..151 155 39.3 Plus
jp-PE 1054 CG4405-PE 1..196 14..158 155 27.1 Plus
jp-PD 1054 CG4405-PD 1..196 14..158 155 27.1 Plus

GH04877.pep Sequence

Translation from 13 to 609

> GH04877.pep
MAMDDYDDDMSSVGVTTARIENQHQQHPHQQGQHGHHQQGQGQSQYSAGA
VKVGGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGV
GCLWFADGAKYEGEFHQGWFHGNGIFWRADGMKYEGEFRGGKIWGLGLLT
FQDFTHGFPRNEGFFQDCRFMRRRRCPEVVQRAQKCALMARSQCEHPY*

GH04877.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16068-PA 200 GF16068-PA 1..200 1..198 999 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11144-PA 198 GG11144-PA 1..198 1..198 1038 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22742-PA 195 GH22742-PA 11..195 11..198 829 87.2 Plus
Dgri\GH11395-PA 341 GH11395-PA 26..102 63..139 152 44.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
rtp-PA 198 CG10233-PA 1..198 1..198 1127 100 Plus
CG14490-PA 197 CG14490-PA 15..170 25..158 161 32.5 Plus
CG5458-PA 344 CG5458-PA 33..143 47..157 159 33 Plus
CG5458-PA 344 CG5458-PA 27..110 64..147 155 39.3 Plus
jp-PE 1054 CG4405-PE 1..196 10..154 155 27.1 Plus
jp-PD 1054 CG4405-PD 1..196 10..154 155 27.1 Plus
jp-PA 1054 CG4405-PA 1..196 10..154 155 27.1 Plus
jp-PB 1054 CG4405-PB 1..196 10..154 155 27.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10217-PA 190 GI10217-PA 11..190 11..198 811 86.7 Plus
Dmoj\GI18099-PA 348 GI18099-PA 26..102 63..139 142 41.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22197-PA 234 GL22197-PA 38..234 1..198 984 95.5 Plus
Dper\GL16824-PA 305 GL16824-PA 113..181 58..127 142 41.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10177-PA 232 GA10177-PA 38..232 1..198 979 95.5 Plus
Dpse\GA15841-PA 305 GA15841-PA 113..181 58..127 143 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10655-PA 198 GM10655-PA 1..198 1..198 1037 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19636-PA 198 GD19636-PA 1..198 1..198 1037 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11018-PA 187 GJ11018-PA 1..187 1..198 840 86.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14288-PA 203 GK14288-PA 15..203 13..198 793 86.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25303-PA 198 GE25303-PA 11..198 11..198 878 95.7 Plus