GH05159.complete Sequence
620 bp (620 high quality bases) assembled on 2002-10-15
GenBank Submission: BT001391
> GH05159.complete
CACAAACAAAGCAGCACACAAAAACCGAATTCGAGCTCAGAGCTCAAAAA
ACGAGAAAAAAACGTAGCTACAAAAATGTTGACCACGATGAGAGGCAGCG
CAAAGAAACTTCCCATCTGGCCACTGACCCATTTTCGCAGATTCCCGACA
TTGATTAAATCCCACGCAAGTTCCGAAGAAAAATTTGAGCAAAAAGCTGA
GGAAGTGGACGGCGTATCCAATATGAAGCTACCCTACTTTATAAGCCCAA
GGTGTGTTCAAAATCAGGATCAACTGGTTGATGGGCAGACGAAAATGTTC
ACCTACAACTATCATCCGTTTTCCATTTACGATTTAAATGAAGCTACTCT
TCGCGCCAAGCAAGCAGCAGATGAGTATTCAAAGAAAATTGATGAGTTGC
AAAAGCGTAAGATTGAATATGTAAACAAGTAGTTGGTGACAATAATCTCA
TTAATAGATAAGCGATGATATCATACAATGAGGATTGAATTATTTACTTA
CTATTAAAGATAGAAATATTCAAAATATTAATGTTTACAGACAACAACTA
AAAATAATTTCAAATCAATAAACTCACCGCAGCCTAGTTAGGCACACAGC
AAAAAAAAAAAAAAAAAAAA
GH05159.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:45:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16964-RA | 700 | CG16964-RA | 35..638 | 1..604 | 3020 | 100 | Plus |
CG16964.a | 583 | CG16964.a | 31..441 | 1..411 | 2040 | 99.7 | Plus |
CG16964.a | 583 | CG16964.a | 437..583 | 458..604 | 735 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:22:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 11946752..11947281 | 71..600 | 2635 | 99.8 | Plus |
chr2L | 23010047 | chr2L | 11946612..11946681 | 1..70 | 350 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:22:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11948105..11948638 | 71..604 | 2670 | 100 | Plus |
2L | 23513712 | 2L | 11947965..11948034 | 1..70 | 350 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11948105..11948638 | 71..604 | 2670 | 100 | Plus |
2L | 23513712 | 2L | 11947965..11948034 | 1..70 | 350 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 07:22:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 6895..7006 | 473..581 | 121 | 60.5 | Plus |
Idefix | 7411 | Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). | 745..807 | 509..571 | 108 | 63.5 | Plus |
GH05159.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:23:51 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 11946612..11946681 | 1..70 | 100 | -> | Plus |
chr2L | 11946752..11947281 | 71..600 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:17:28 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..357 | 76..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:03 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..357 | 76..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:30:56 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..357 | 76..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:02 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..357 | 76..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:31:50 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..357 | 76..432 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:44 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..600 | 1..600 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:02 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..600 | 1..600 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:30:56 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RB | 25..624 | 1..600 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:02 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RA | 1..600 | 1..600 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:31:50 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16964-RB | 25..624 | 1..600 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:51 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11947965..11948034 | 1..70 | 100 | -> | Plus |
2L | 11948105..11948634 | 71..600 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:51 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11947965..11948034 | 1..70 | 100 | -> | Plus |
2L | 11948105..11948634 | 71..600 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:51 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11947965..11948034 | 1..70 | 100 | -> | Plus |
2L | 11948105..11948634 | 71..600 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:30:56 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11947965..11948034 | 1..70 | 100 | -> | Plus |
arm_2L | 11948105..11948634 | 71..600 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:52 Download gff for
GH05159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11948105..11948634 | 71..600 | 100 | | Plus |
2L | 11947965..11948034 | 1..70 | 100 | -> | Plus |
GH05159.hyp Sequence
Translation from 1 to 431
> GH05159.hyp
HKQSSTQKPNSSSELKKREKNVATKMLTTMRGSAKKLPIWPLTHFRRFPT
LIKSHASSEEKFEQKAEEVDGVSNMKLPYFISPRCVQNQDQLVDGQTKMF
TYNYHPFSIYDLNEATLRAKQAADEYSKKIDELQKRKIEYVNK*
GH05159.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16964-PB | 118 | CG16964-PB | 1..118 | 26..143 | 618 | 100 | Plus |
CG16964-PA | 118 | CG16964-PA | 1..118 | 26..143 | 618 | 100 | Plus |
GH05159.pep Sequence
Translation from 75 to 431
> GH05159.pep
MLTTMRGSAKKLPIWPLTHFRRFPTLIKSHASSEEKFEQKAEEVDGVSNM
KLPYFISPRCVQNQDQLVDGQTKMFTYNYHPFSIYDLNEATLRAKQAADE
YSKKIDELQKRKIEYVNK*
GH05159.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:00:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16669-PA | 112 | GG16669-PA | 1..111 | 1..111 | 454 | 74.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16964-PB | 118 | CG16964-PB | 1..118 | 1..118 | 618 | 100 | Plus |
CG16964-PA | 118 | CG16964-PA | 1..118 | 1..118 | 618 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:00:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26667-PA | 118 | GM26667-PA | 1..118 | 1..118 | 594 | 93.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:00:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23799-PA | 118 | GD23799-PA | 1..118 | 1..118 | 590 | 92.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:00:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18555-PA | 116 | GE18555-PA | 1..116 | 1..118 | 477 | 78 | Plus |