Clone GH05159 Report

Search the DGRC for GH05159

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:51
Well:59
Vector:pOT2
Associated Gene/TranscriptCG16964-RA
Protein status:GH05159.pep: gold
Sequenced Size:620

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16964 2002-01-01 Sim4 clustering to Release 2
CG16964 2002-10-15 Blastp of sequenced clone
CG16964 2003-01-01 Sim4 clustering to Release 3
CG16964 2008-04-29 Release 5.5 accounting
CG16964 2008-08-15 Release 5.9 accounting
CG16964 2008-12-18 5.12 accounting

Clone Sequence Records

GH05159.complete Sequence

620 bp (620 high quality bases) assembled on 2002-10-15

GenBank Submission: BT001391

> GH05159.complete
CACAAACAAAGCAGCACACAAAAACCGAATTCGAGCTCAGAGCTCAAAAA
ACGAGAAAAAAACGTAGCTACAAAAATGTTGACCACGATGAGAGGCAGCG
CAAAGAAACTTCCCATCTGGCCACTGACCCATTTTCGCAGATTCCCGACA
TTGATTAAATCCCACGCAAGTTCCGAAGAAAAATTTGAGCAAAAAGCTGA
GGAAGTGGACGGCGTATCCAATATGAAGCTACCCTACTTTATAAGCCCAA
GGTGTGTTCAAAATCAGGATCAACTGGTTGATGGGCAGACGAAAATGTTC
ACCTACAACTATCATCCGTTTTCCATTTACGATTTAAATGAAGCTACTCT
TCGCGCCAAGCAAGCAGCAGATGAGTATTCAAAGAAAATTGATGAGTTGC
AAAAGCGTAAGATTGAATATGTAAACAAGTAGTTGGTGACAATAATCTCA
TTAATAGATAAGCGATGATATCATACAATGAGGATTGAATTATTTACTTA
CTATTAAAGATAGAAATATTCAAAATATTAATGTTTACAGACAACAACTA
AAAATAATTTCAAATCAATAAACTCACCGCAGCCTAGTTAGGCACACAGC
AAAAAAAAAAAAAAAAAAAA

GH05159.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG16964-RA 700 CG16964-RA 35..638 1..604 3020 100 Plus
CG16964.a 583 CG16964.a 31..441 1..411 2040 99.7 Plus
CG16964.a 583 CG16964.a 437..583 458..604 735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11946752..11947281 71..600 2635 99.8 Plus
chr2L 23010047 chr2L 11946612..11946681 1..70 350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:32:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11948105..11948638 71..604 2670 100 Plus
2L 23513712 2L 11947965..11948034 1..70 350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11948105..11948638 71..604 2670 100 Plus
2L 23513712 2L 11947965..11948034 1..70 350 100 Plus
Blast to na_te.dros performed 2019-03-16 07:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6895..7006 473..581 121 60.5 Plus
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 745..807 509..571 108 63.5 Plus

GH05159.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:23:51 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11946612..11946681 1..70 100 -> Plus
chr2L 11946752..11947281 71..600 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:17:28 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..357 76..432 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:03 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..357 76..432 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:30:56 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..357 76..432 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:02 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..357 76..432 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:31:50 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..357 76..432 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:44 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:02 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:30:56 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RB 25..624 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:02 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:31:50 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
CG16964-RB 25..624 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:51 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11947965..11948034 1..70 100 -> Plus
2L 11948105..11948634 71..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:51 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11947965..11948034 1..70 100 -> Plus
2L 11948105..11948634 71..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:51 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11947965..11948034 1..70 100 -> Plus
2L 11948105..11948634 71..600 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:30:56 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11947965..11948034 1..70 100 -> Plus
arm_2L 11948105..11948634 71..600 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:52 Download gff for GH05159.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11948105..11948634 71..600 100   Plus
2L 11947965..11948034 1..70 100 -> Plus

GH05159.hyp Sequence

Translation from 1 to 431

> GH05159.hyp
HKQSSTQKPNSSSELKKREKNVATKMLTTMRGSAKKLPIWPLTHFRRFPT
LIKSHASSEEKFEQKAEEVDGVSNMKLPYFISPRCVQNQDQLVDGQTKMF
TYNYHPFSIYDLNEATLRAKQAADEYSKKIDELQKRKIEYVNK*

GH05159.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG16964-PB 118 CG16964-PB 1..118 26..143 618 100 Plus
CG16964-PA 118 CG16964-PA 1..118 26..143 618 100 Plus

GH05159.pep Sequence

Translation from 75 to 431

> GH05159.pep
MLTTMRGSAKKLPIWPLTHFRRFPTLIKSHASSEEKFEQKAEEVDGVSNM
KLPYFISPRCVQNQDQLVDGQTKMFTYNYHPFSIYDLNEATLRAKQAADE
YSKKIDELQKRKIEYVNK*

GH05159.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16669-PA 112 GG16669-PA 1..111 1..111 454 74.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG16964-PB 118 CG16964-PB 1..118 1..118 618 100 Plus
CG16964-PA 118 CG16964-PA 1..118 1..118 618 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26667-PA 118 GM26667-PA 1..118 1..118 594 93.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23799-PA 118 GD23799-PA 1..118 1..118 590 92.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18555-PA 116 GE18555-PA 1..116 1..118 477 78 Plus