Clone GH05530 Report

Search the DGRC for GH05530

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:55
Well:30
Vector:pOT2
Associated Gene/TranscriptCG17567-RA
Protein status:GH05530.pep: wuzgold
Preliminary Size:407
Sequenced Size:424

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17567 2002-01-01 Sim4 clustering to Release 2
CG17567 2002-05-18 Blastp of sequenced clone
CG17567 2003-01-01 Sim4 clustering to Release 3
CG17567 2008-04-29 Release 5.5 accounting
CG17567 2008-08-15 Release 5.9 accounting
CG17567 2008-12-18 5.12 accounting

Clone Sequence Records

GH05530.complete Sequence

424 bp (424 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118741

> GH05530.complete
ACACCTTTGAAAATAGTTTGTGTCTTACGTTTTCCGGTACCTATTTTGTT
GTTTCTAAGATCCTATTTCTGTAAATAGGCCAAATTCCACTTAGCTGCCC
TTTTAGAAGGAAATTAGGATACCCTGAACGCTTTTCCCCAAGACAAAATA
AAATCATCATGTGCTGCGGACCCTGTGGACCTCGCTGCTGCGATCCGTGC
GGCGGATGCTACAACTGCTGCGTGGAACTCTGCTGTGTACCCTGCACCCC
AGCCTACATCCAGTGCTCATTTATGCCCTGCGGACCAAGAGGCTGTTGCT
GAAGTGGGGATGTGCCAGGTGCCGAAACACGTTCAACCATATTGTACCTG
AAACACTCGTAGATACCCAACATGTCCCAATAAACGAATTTTATAAATGT
TAAAAAAAAAAAAAAAAAAAAAAA

GH05530.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG17567-RA 613 CG17567-RA 192..594 1..403 2015 100 Plus
CG17567-RC 424 CG17567-RC 18..424 1..403 1950 99 Plus
CG17567-RD 411 CG17567-RD 103..411 95..403 1545 100 Plus
CG17567-RD 411 CG17567-RD 18..102 1..85 425 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19181678..19181923 401..156 1215 99.6 Minus
chr2L 23010047 chr2L 19182097..19182181 85..1 425 100 Minus
chr2L 23010047 chr2L 19181977..19182050 155..82 355 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:33:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183091..19183338 403..156 1240 100 Minus
2L 23513712 2L 19183512..19183596 85..1 425 100 Minus
2L 23513712 2L 19183392..19183465 155..82 355 98.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183091..19183338 403..156 1240 100 Minus
2L 23513712 2L 19183512..19183596 85..1 425 100 Minus
2L 23513712 2L 19183392..19183465 155..82 355 98.6 Minus
Blast to na_te.dros performed on 2019-03-15 15:26:08 has no hits.

GH05530.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:26:51 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19181678..19181923 156..401 99 <- Minus
chr2L 19181977..19182046 86..155 100 <- Minus
chr2L 19182097..19182181 1..85 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:18:15 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RC 1..196 206..401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:41 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RC 1..196 206..401 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:18:53 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RC 1..196 206..401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:06:57 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 1..144 159..302 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:46:23 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RA 18..418 1..401 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:41 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RA 18..418 1..401 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:18:53 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RA 18..418 1..401 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:06:57 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 5..405 1..401 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:51 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19183392..19183461 86..155 100 <- Minus
2L 19183512..19183596 1..85 100   Minus
2L 19183093..19183338 156..401 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:51 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19183392..19183461 86..155 100 <- Minus
2L 19183512..19183596 1..85 100   Minus
2L 19183093..19183338 156..401 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:51 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19183392..19183461 86..155 100 <- Minus
2L 19183512..19183596 1..85 100   Minus
2L 19183093..19183338 156..401 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:29:18 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183093..19183338 156..401 100 <- Minus
arm_2L 19183392..19183461 86..155 100 <- Minus
arm_2L 19183512..19183596 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:29:18 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183093..19183338 156..401 100 <- Minus
arm_2L 19183392..19183461 86..155 100 <- Minus
arm_2L 19183512..19183596 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:29:18 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183093..19183338 156..401 100 <- Minus
arm_2L 19183392..19183461 86..155 100 <- Minus
arm_2L 19183512..19183596 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:40 Download gff for GH05530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19183093..19183338 156..401 100 <- Minus
2L 19183392..19183461 86..155 100 <- Minus
2L 19183512..19183596 1..85 100   Minus

GH05530.hyp Sequence

Translation from 205 to 400

> GH05530.hyp
MLQLLRGTLLCTLHPSLHPVLIYALRTKRLLLKWGCARCRNTFNHIVPET
LVDTQHVPINEFYKC
Sequence GH05530.hyp has no blast hits.

GH05530.pep Sequence

Translation from 205 to 402

> GH05530.pep
MLQLLRGTLLCTLHPSLHPVLIYALRTKRLLLKWGCARCRNTFNHIVPET
LVDTQHVPINEFYKC*

GH05530.pep Blast Records

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17023-PA 65 GM17023-PA 1..65 1..65 286 87.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12663-PA 57 GE12663-PA 1..54 1..54 195 72.2 Plus