Clone GH05615 Report

Search the DGRC for GH05615

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:56
Well:15
Vector:pOT2
Associated Gene/Transcriptto-RA
Protein status:GH05615.pep: gold
Preliminary Size:1300
Sequenced Size:1056

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11853 2001-01-01 Release 2 assignment
CG11853 2002-06-12 Blastp of sequenced clone
CG11853 2003-01-01 Sim4 clustering to Release 3
to 2008-04-29 Release 5.5 accounting
to 2008-08-15 Release 5.9 accounting
to 2008-12-18 5.12 accounting

Clone Sequence Records

GH05615.complete Sequence

1056 bp (1056 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122096

> GH05615.complete
ACGTGTTAGCATGTTCGCAATCGCATTCGCAGTGGTTTTGTGCCTTTTGG
TCTCGGTGGATGCCAAATTCCCCGAAGATCCAAAACCTTGTAAGTATGGT
GATGGCGAATGTATCATGAAGCTGTGCAACACCCTGTTCAGCGAAAACTC
GGCGGAGGGGGATCCTGGTCTGAACCTGATGCAGCTGGATCCGTTGAAGG
TGGATCGGATGGTTATTAGCCAGGGTGAGAGCTCCAGTCCCGTGGGCATA
ACTCTAACCTTCACCGACAATCTGTTGTATGGGATCAAGGACCAAAGGAT
CGTCAAAGTAAAGGGTTTCGGAAGGGATCTCACCGCCAAGCACGAAGTGA
AAATTGTCACGAAAACCTTCTCACTCGTTGGACCCTATAACATCCAGGGC
AAGGTACTCATTCTACCGATCAGCGGAACTGGACAGAGTAACATGACAAT
GGTTAACGTCAGGGCAATCGTCAGCTTCTCGGGCAAACCGCTGGTGAAGA
ATGGGGAGACCTACCTGGACGTTACCGATCTGAAAATAACGATGAAGCCG
GAGTCCAGCCACTACCATTTCAGTAATCTGTTCAATGGGGACAAGGCGCT
GGGTGACAACATGAATGTCTTCCTCAACGAAAACTCGGAGGCCATTTACA
AGGAGACGGCCAAAGCAATCGACCGATCCTTTGGCAAACTTTACCTGGGC
GTCGTCAAAGGTGTGTTCTCCAAACTGCCGTATGCCAAGTTTTTTGCGGA
TGAATCGTGAGTTAGCTCTTCAAAGTGGGCAGAGTCCACATAAAGATACT
AGATCATGTTGTTTGCGTACTGACAGATCTAAGTTTTGAGGCTAGCAATC
ATCATTAGGTTTAATGGAGTTCGTGTTTCGCGTTTGAAAGTGAGAACACA
AGTAACTACTATTAAGCCATCTCAGCTAAATAATCTGTAAGTGTTGTGTG
GCAATAAAAGTTACATATATGTAGTTAGCACATTGTAAATTATTTATAAG
TGATACAAAGAATTCTGTAAAATACCATAAAAACATTTAAAAAAAAAAAA
AAAAAA

GH05615.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
to.d 1291 to.d 39..1080 1..1042 5210 100 Plus
to-RA 1291 to-RA 39..1080 1..1042 5210 100 Plus
to.a 1179 to.a 203..1173 72..1042 4855 100 Plus
to.a 1179 to.a 17..87 1..71 355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21063948..21064535 452..1038 2830 99.1 Plus
chr3R 27901430 chr3R 21063447..21063688 72..313 1180 99.2 Plus
chr3R 27901430 chr3R 21063755..21063898 313..456 705 99.3 Plus
chr3R 27901430 chr3R 21063261..21063331 1..71 355 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:33:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25240867..25241457 452..1042 2955 100 Plus
3R 32079331 3R 25240366..25240607 72..313 1210 100 Plus
3R 32079331 3R 25240674..25240817 313..456 705 99.3 Plus
3R 32079331 3R 25240180..25240250 1..71 355 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24981698..24982288 452..1042 2955 100 Plus
3R 31820162 3R 24981197..24981438 72..313 1210 100 Plus
3R 31820162 3R 24981505..24981648 313..456 705 99.3 Plus
3R 31820162 3R 24981011..24981081 1..71 355 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:50:55 has no hits.

GH05615.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:51:38 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21063261..21063331 1..71 100 -> Plus
chr3R 21063447..21063687 72..312 99 -> Plus
chr3R 21063755..21063894 313..452 100 -> Plus
chr3R 21063949..21064535 453..1038 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:18:35 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..750 11..760 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:40 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..750 11..760 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:03 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..750 11..760 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:14:21 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..750 11..760 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:43 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..750 11..760 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:51 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:40 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:03 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:14:21 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:43 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
to-RA 1..1038 1..1038 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:38 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25240180..25240250 1..71 100 -> Plus
3R 25240366..25240606 72..312 100 -> Plus
3R 25240674..25240813 313..452 100 -> Plus
3R 25240868..25241453 453..1038 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:38 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25240180..25240250 1..71 100 -> Plus
3R 25240366..25240606 72..312 100 -> Plus
3R 25240674..25240813 313..452 100 -> Plus
3R 25240868..25241453 453..1038 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:38 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25240180..25240250 1..71 100 -> Plus
3R 25240366..25240606 72..312 100 -> Plus
3R 25240674..25240813 313..452 100 -> Plus
3R 25240868..25241453 453..1038 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:03 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21065902..21065972 1..71 100 -> Plus
arm_3R 21066088..21066328 72..312 100 -> Plus
arm_3R 21066396..21066535 313..452 100 -> Plus
arm_3R 21066590..21067175 453..1038 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:47:17 Download gff for GH05615.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24981197..24981437 72..312 100 -> Plus
3R 24981505..24981644 313..452 100 -> Plus
3R 24981699..24982284 453..1038 100   Plus
3R 24981011..24981081 1..71 100 -> Plus

GH05615.hyp Sequence

Translation from 1 to 759

> GH05615.hyp
RVSMFAIAFAVVLCLLVSVDAKFPEDPKPCKYGDGECIMKLCNTLFSENS
AEGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRI
VKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTM
VNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKAL
GDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFAD
ES*

GH05615.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
to-PB 249 CG11853-PB 1..249 4..252 1279 100 Plus
to-PA 249 CG11853-PA 1..249 4..252 1279 100 Plus
CG11852-PA 250 CG11852-PA 3..249 4..250 341 30.6 Plus
CG11854-PB 250 CG11854-PB 23..248 23..248 316 31.7 Plus
CG2650-PA 260 CG2650-PA 7..260 3..251 298 29.8 Plus

GH05615.pep Sequence

Translation from 10 to 759

> GH05615.pep
MFAIAFAVVLCLLVSVDAKFPEDPKPCKYGDGECIMKLCNTLFSENSAEG
DPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKV
KGFGRDLTAKHEVKIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNV
RAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDN
MNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFADES*

GH05615.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17553-PA 248 GF17553-PA 1..248 1..248 919 68.1 Plus
Dana\GF17552-PA 250 GF17552-PA 3..250 1..248 327 30.5 Plus
Dana\GF17554-PA 254 GF17554-PA 24..250 19..245 326 32.5 Plus
Dana\GF21371-PA 263 GF21371-PA 25..263 13..248 285 27.9 Plus
Dana\GF20756-PA 251 GF20756-PA 19..249 12..245 262 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11379-PA 248 GG11379-PA 1..248 1..248 1222 93.5 Plus
Dere\GG11378-PA 250 GG11378-PA 3..249 1..247 346 31.5 Plus
Dere\GG11380-PA 250 GG11380-PA 21..249 18..246 338 33.2 Plus
Dere\GG11299-PA 251 GG11299-PA 8..249 1..245 278 28.6 Plus
Dere\GG18615-PA 260 GG18615-PA 8..260 2..248 258 28 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17381-PA 246 GH17381-PA 1..246 1..247 735 55.5 Plus
Dgri\GH14735-PA 237 GH14735-PA 1..237 1..247 608 45.3 Plus
Dgri\GH17380-PA 248 GH17380-PA 18..248 18..248 301 29.7 Plus
Dgri\GH18827-PA 250 GH18827-PA 6..248 7..245 283 29.3 Plus
Dgri\GH17382-PA 259 GH17382-PA 23..252 18..247 280 29 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
to-PB 249 CG11853-PB 1..249 1..249 1279 100 Plus
to-PA 249 CG11853-PA 1..249 1..249 1279 100 Plus
CG11852-PA 250 CG11852-PA 3..249 1..247 341 30.6 Plus
CG11854-PB 250 CG11854-PB 23..248 20..245 316 31.7 Plus
CG2650-PA 260 CG2650-PA 8..260 1..248 294 29.5 Plus
CG13618-PA 252 CG13618-PA 9..250 1..245 281 29 Plus
CG14457-PB 271 CG14457-PB 16..255 11..248 225 26.5 Plus
CG10407-PB 259 CG10407-PB 65..253 49..241 224 27.5 Plus
CG10407-PA 259 CG10407-PA 65..253 49..241 224 27.5 Plus
CG14457-PC 270 CG14457-PC 16..254 11..248 222 26.6 Plus
CG17279-PD 245 CG17279-PD 1..245 1..247 215 26.1 Plus
CG10407-PC 263 CG10407-PC 65..257 49..241 210 26.9 Plus
CG10264-PA 270 CG10264-PA 35..264 16..240 195 24.6 Plus
CG7079-PB 255 CG7079-PB 21..248 19..245 181 23.5 Plus
CG7079-PA 255 CG7079-PA 21..248 19..245 181 23.5 Plus
CG1124-PA 246 CG1124-PA 4..246 3..247 179 24.7 Plus
CG14661-PB 246 CG14661-PB 6..244 4..245 177 23.7 Plus
CG14661-PA 246 CG14661-PA 6..244 4..245 177 23.7 Plus
CG14457-PA 144 CG14457-PA 3..128 122..248 175 30.7 Plus
CG31189-PB 258 CG31189-PB 13..248 11..245 174 22.8 Plus
CG31207-PA 258 CG31207-PA 5..247 4..245 169 22 Plus
CG17189-PC 271 CG17189-PC 69..255 59..248 166 23.6 Plus
CG17189-PB 271 CG17189-PB 69..255 59..248 166 23.6 Plus
CG14259-PA 289 CG14259-PA 86..271 60..248 156 24.2 Plus
CG14258-PA 258 CG14258-PA 10..256 7..247 154 22.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23925-PA 241 GI23925-PA 1..241 1..247 674 51.8 Plus
Dmoj\GI23924-PA 255 GI23924-PA 2..255 1..248 352 31.4 Plus
Dmoj\GI23926-PA 238 GI23926-PA 8..237 18..247 327 31.8 Plus
Dmoj\GI10085-PA 254 GI10085-PA 16..252 4..245 280 29.3 Plus
Dmoj\GI16254-PA 228 GI16254-PA 2..228 25..248 245 28.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11988-PA 251 GL11988-PA 1..248 1..248 796 57.7 Plus
Dper\GL11987-PA 250 GL11987-PA 8..249 5..247 335 31.1 Plus
Dper\GL11989-PA 256 GL11989-PA 27..254 18..245 330 31.4 Plus
Dper\GL21869-PA 240 GL21869-PA 46..238 49..245 267 30.7 Plus
Dper\GL18241-PA 270 GL18241-PA 1..258 4..249 256 25.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11237-PA 251 GA11237-PA 1..248 1..248 796 57.7 Plus
Dpse\GA11236-PA 250 GA11236-PA 8..249 5..247 335 31.1 Plus
Dpse\GA11238-PA 256 GA11238-PA 27..254 18..245 329 31.4 Plus
Dpse\GA12411-PA 253 GA12411-PA 10..251 1..245 274 28.6 Plus
Dpse\GA15409-PA 268 GA15409-PA 1..256 4..249 269 25.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17822-PA 249 GM17822-PA 1..249 1..249 1305 99.6 Plus
Dsec\GM17820-PA 250 GM17820-PA 3..249 1..247 334 29.8 Plus
Dsec\GM17823-PA 246 GM17823-PA 21..244 18..245 305 31.4 Plus
Dsec\GM18865-PA 260 GM18865-PA 8..260 1..248 291 29.1 Plus
Dsec\GM26607-PA 119 GM26607-PA 1..117 128..245 226 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21190-PA 241 GD21190-PA 1..241 1..249 1222 95.2 Plus
Dsim\GD21189-PA 250 GD21189-PA 3..249 1..247 337 30.2 Plus
Dsim\GD21191-PA 250 GD21191-PA 21..248 18..245 328 32.9 Plus
Dsim\GD24605-PA 260 GD24605-PA 8..260 1..248 287 28.3 Plus
Dsim\GD15043-PA 271 GD15043-PA 6..255 1..248 229 25.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24018-PA 246 GJ24018-PA 1..246 1..247 747 55.5 Plus
Dvir\GJ24019-PA 245 GJ24019-PA 1..245 1..247 667 51.6 Plus
Dvir\GJ24020-PA 255 GJ24020-PA 27..254 20..247 343 31.2 Plus
Dvir\GJ24016-PA 251 GJ24016-PA 13..251 10..248 324 30.8 Plus
Dvir\GJ23820-PA 254 GJ23820-PA 15..252 3..245 288 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13451-PA 244 GK13451-PA 11..242 8..240 527 49.4 Plus
Dwil\GK13452-PA 254 GK13452-PA 6..253 3..247 362 32.9 Plus
Dwil\GK13450-PA 250 GK13450-PA 8..249 5..247 338 31.6 Plus
Dwil\GK19974-PA 256 GK19974-PA 12..256 8..247 240 27.6 Plus
Dwil\GK16767-PA 272 GK16767-PA 7..256 2..247 231 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\to-PA 248 GE23576-PA 1..248 1..248 1239 94.8 Plus
Dyak\GE23575-PA 251 GE23575-PA 4..250 1..247 343 30.2 Plus
Dyak\GE23577-PA 250 GE23577-PA 21..248 18..245 335 32.9 Plus
Dyak\GE23494-PA 251 GE23494-PA 8..249 1..245 277 28.6 Plus
Dyak\GE16930-PA 260 GE16930-PA 29..260 20..248 254 27.5 Plus