BDGP Sequence Production Resources |
Search the DGRC for GH05668
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 56 |
Well: | 68 |
Vector: | pOT2 |
Associated Gene/Transcript | Tsp42Ea-RA |
Protein status: | GH05668.pep: gold |
Preliminary Size: | 1300 |
Sequenced Size: | 1120 |
Gene | Date | Evidence |
---|---|---|
CG18817 | 2003-04-01 | Blastp of sequenced clone |
Tsp42Ea | 2008-04-29 | Release 5.5 accounting |
Tsp42Ea | 2008-08-15 | Release 5.9 accounting |
CG30159 | 2008-08-15 | Release 5.9 accounting |
Tsp42Ea | 2008-12-18 | 5.12 accounting |
CG30159 | 2008-12-18 | 5.12 accounting |
1120 bp (1120 high quality bases) assembled on 2003-04-01
GenBank Submission: AY069049
> GH05668.complete TTAGCATTGTCAACTGCTCACGAACGGTTCGAAAAGCGGAGCGCGCGTAA AATCATTCTGTAAATCATTCAAAAGGCGGAAAACTCAAGTTGCAGTTCTT CATCCATCTCCACCAGCAATCTCTGGCAAAACTCAGGCAAAATGAGCTGC GGAATCTCCATGGTTAAATATATCCTATTTATATTTAATTTGCTCTGTTC GATATGCGGCATATTGCTGATCGTATTCGGAGCTCTGCTGTTCAGCAAAG TCCGTAACATGGATGACTTCGCGGAAGCCCTGCGAACCCAGCAGGTGCCC GTAACGATGATCATCCTGGGCACCATCATCCTGCTGATTTCCTGGTTCGG CTGCTGCGGAGCCATTCGGGAATCCTACTGCATGTCCATGACGTACTCGA TCTTGCTGTTCGTCCTGATGATTGGCCAACTGGCTTTGGTGATCTACATG TGGGTGCAGAAGGACAAGTACCTGGAGATCATGGGCGACGTGGTCGAGAA GGCCTGGAACCATCGCACCAGTCGTTCCGACTACATGGACGCGATTCAGA TCAGCATGAAATGCTGCGGACGCAGTGGCTACACCGACTACGCCTACCAG GGCAAGTTCCCTCCCTCCTGCTGCAGCGACACCAACAACTGCCGCTGGGA GACCGTCTACCGGCGGGGATGCAAGGTCACCTTCGTTGAGTTCTGGGACA GGAACAGCGACATCATCAAGTATGCCGGTCTGGTCATCGCCGCCATCGAA TTTGTGGGATTCGTTTTCGCCTGTTGCTTGGCGAACAGCATTCGGAACTA TAGACGCCGTGCGGAATATTAATCGACAAAGGACTAAGGCCTTGCACTAA TTTTAATTGAAACCGAAAGTACGAATTATGTTGCCCAATTTTACGAATAT TTACCTGATACAGATGGCCATTCAAATTTGCATAATCTCAAGCGTAAGCA GCAAATGCAGCAAATCCAATGACGAATGCGTAACGATCACTTTTGTAAGA TCGTTTGTTCAAAGTTACACTGAATGTGCTAATATGTTTAACTGTACAAA ATAACTTATACTCCTGGAGATTGCAATAAACGGAGAAATTTATTTACAAT TTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 2885025..2885376 | 751..1102 | 1760 | 100 | Plus |
chr2R | 21145070 | chr2R | 2891313..2891664 | 751..1102 | 1760 | 100 | Plus |
chr2R | 21145070 | chr2R | 2884567..2884761 | 556..750 | 975 | 100 | Plus |
chr2R | 21145070 | chr2R | 2890856..2891050 | 556..750 | 975 | 100 | Plus |
chr2R | 21145070 | chr2R | 2884083..2884275 | 201..393 | 965 | 100 | Plus |
chr2R | 21145070 | chr2R | 2890372..2890564 | 201..393 | 965 | 100 | Plus |
chr2R | 21145070 | chr2R | 2884338..2884500 | 393..555 | 815 | 100 | Plus |
chr2R | 21145070 | chr2R | 2890627..2890789 | 393..555 | 815 | 100 | Plus |
chr2R | 21145070 | chr2R | 2881778..2881891 | 88..201 | 570 | 100 | Plus |
chr2R | 21145070 | chr2R | 2880096..2880184 | 1..89 | 445 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 6997617..6997969 | 751..1103 | 1765 | 100 | Plus |
2R | 25286936 | 2R | 7003905..7004257 | 751..1103 | 1765 | 100 | Plus |
2R | 25286936 | 2R | 6997159..6997353 | 556..750 | 975 | 100 | Plus |
2R | 25286936 | 2R | 7003448..7003642 | 556..750 | 975 | 100 | Plus |
2R | 25286936 | 2R | 6996675..6996867 | 201..393 | 965 | 100 | Plus |
2R | 25286936 | 2R | 7002964..7003156 | 201..393 | 965 | 100 | Plus |
2R | 25286936 | 2R | 6996930..6997092 | 393..555 | 815 | 100 | Plus |
2R | 25286936 | 2R | 7003219..7003381 | 393..555 | 815 | 100 | Plus |
2R | 25286936 | 2R | 6994371..6994484 | 88..201 | 570 | 100 | Plus |
2R | 25286936 | 2R | 6992689..6992777 | 1..89 | 445 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 7005104..7005456 | 751..1103 | 1765 | 100 | Plus |
2R | 25260384 | 2R | 6998816..6999168 | 751..1103 | 1765 | 100 | Plus |
2R | 25260384 | 2R | 7004647..7004841 | 556..750 | 975 | 100 | Plus |
2R | 25260384 | 2R | 6998358..6998552 | 556..750 | 975 | 100 | Plus |
2R | 25260384 | 2R | 7004163..7004355 | 201..393 | 965 | 100 | Plus |
2R | 25260384 | 2R | 6997874..6998066 | 201..393 | 965 | 100 | Plus |
2R | 25260384 | 2R | 7004418..7004580 | 393..555 | 815 | 100 | Plus |
2R | 25260384 | 2R | 6998129..6998291 | 393..555 | 815 | 100 | Plus |
2R | 25260384 | 2R | 6995570..6995683 | 88..201 | 570 | 100 | Plus |
2R | 25260384 | 2R | 6993888..6993976 | 1..89 | 445 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 2884339..2884500 | 394..555 | 100 | -> | Plus |
chr2R | 2884567..2884761 | 556..750 | 100 | -> | Plus |
chr2R | 2885025..2885376 | 751..1102 | 100 | Plus | |
chr2R | 2880096..2880184 | 1..89 | 100 | -> | Plus |
chr2R | 2881780..2881891 | 90..201 | 100 | -> | Plus |
chr2R | 2884084..2884275 | 202..393 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RC | 1..681 | 142..822 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RC | 1..681 | 142..822 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RA | 1..681 | 142..822 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RC | 1..681 | 142..822 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RA | 1..681 | 142..822 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RB | 14..1115 | 1..1102 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RB | 14..1115 | 1..1102 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RA | 14..1115 | 1..1102 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RB | 14..1115 | 1..1102 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42Ea-RA | 14..1115 | 1..1102 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6997159..6997353 | 556..750 | 100 | -> | Plus |
2R | 6997617..6997968 | 751..1102 | 100 | Plus | |
2R | 6992689..6992777 | 1..89 | 100 | -> | Plus |
2R | 6994373..6994484 | 90..201 | 100 | -> | Plus |
2R | 6996676..6996867 | 202..393 | 100 | -> | Plus |
2R | 6996931..6997092 | 394..555 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6997159..6997353 | 556..750 | 100 | -> | Plus |
2R | 6997617..6997968 | 751..1102 | 100 | Plus | |
2R | 6992689..6992777 | 1..89 | 100 | -> | Plus |
2R | 6994373..6994484 | 90..201 | 100 | -> | Plus |
2R | 6996676..6996867 | 202..393 | 100 | -> | Plus |
2R | 6996931..6997092 | 394..555 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6997159..6997353 | 556..750 | 100 | -> | Plus |
2R | 6997617..6997968 | 751..1102 | 100 | Plus | |
2R | 6992689..6992777 | 1..89 | 100 | -> | Plus |
2R | 6994373..6994484 | 90..201 | 100 | -> | Plus |
2R | 6996676..6996867 | 202..393 | 100 | -> | Plus |
2R | 6996931..6997092 | 394..555 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 2884181..2884372 | 202..393 | 100 | -> | Plus |
arm_2R | 2884436..2884597 | 394..555 | 100 | -> | Plus |
arm_2R | 2884664..2884858 | 556..750 | 100 | -> | Plus |
arm_2R | 2880194..2880282 | 1..89 | 100 | -> | Plus |
arm_2R | 2881878..2881989 | 90..201 | 100 | -> | Plus |
arm_2R | 2885122..2885473 | 751..1102 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6998816..6999167 | 751..1102 | 100 | Plus | |
2R | 6993888..6993976 | 1..89 | 100 | -> | Plus |
2R | 6995572..6995683 | 90..201 | 100 | -> | Plus |
2R | 6997875..6998066 | 202..393 | 100 | -> | Plus |
2R | 6998130..6998291 | 394..555 | 100 | -> | Plus |
2R | 6998358..6998552 | 556..750 | 100 | -> | Plus |
Translation from 141 to 821
> GH05668.hyp MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQ QVPVTMIILGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALV IYMWVQKDKYLEIMGDVVEKAWNHRTSRSDYMDAIQISMKCCGRSGYTDY AYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNSDIIKYAGLVIA AIEFVGFVFACCLANSIRNYRRRAEY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42Ea-PC | 226 | CG18817-PC | 1..226 | 1..226 | 1208 | 100 | Plus |
Tsp42Ea-PB | 226 | CG18817-PB | 1..226 | 1..226 | 1208 | 100 | Plus |
Tsp42Ea-PA | 226 | CG18817-PA | 1..226 | 1..226 | 1208 | 100 | Plus |
Tsp42Ed-PB | 227 | CG12846-PB | 1..227 | 1..226 | 530 | 41.9 | Plus |
Tsp42Ed-PA | 227 | CG12846-PA | 1..227 | 1..226 | 530 | 41.9 | Plus |
Translation from 141 to 821
> GH05668.pep MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQ QVPVTMIILGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALV IYMWVQKDKYLEIMGDVVEKAWNHRTSRSDYMDAIQISMKCCGRSGYTDY AYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNSDIIKYAGLVIA AIEFVGFVFACCLANSIRNYRRRAEY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13154-PA | 226 | GF13154-PA | 1..226 | 1..226 | 1048 | 85.4 | Plus |
Dana\GF12681-PA | 228 | GF12681-PA | 1..228 | 1..226 | 540 | 45.4 | Plus |
Dana\GF12682-PA | 227 | GF12682-PA | 1..227 | 1..226 | 533 | 43.9 | Plus |
Dana\GF12679-PA | 223 | GF12679-PA | 1..221 | 1..218 | 460 | 41.3 | Plus |
Dana\GF12680-PA | 228 | GF12680-PA | 1..224 | 1..224 | 353 | 34.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23240-PA | 226 | GG23240-PA | 1..226 | 1..226 | 1019 | 88.9 | Plus |
Dere\GG10779-PA | 227 | GG10779-PA | 1..227 | 1..226 | 532 | 43.2 | Plus |
Dere\GG23243-PA | 228 | GG23243-PA | 1..228 | 1..226 | 475 | 44.8 | Plus |
Dere\GG23241-PA | 222 | GG23241-PA | 1..221 | 1..219 | 444 | 39.7 | Plus |
Dere\GG23242-PA | 232 | GG23242-PA | 1..223 | 1..219 | 363 | 34.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21494-PA | 226 | GH21494-PA | 1..226 | 1..226 | 1061 | 86.7 | Plus |
Dgri\GH21498-PA | 227 | GH21498-PA | 1..227 | 1..226 | 554 | 46.1 | Plus |
Dgri\GH21499-PA | 230 | GH21499-PA | 1..230 | 1..226 | 495 | 44.4 | Plus |
Dgri\GH21496-PA | 223 | GH21496-PA | 1..222 | 1..219 | 390 | 36 | Plus |
Dgri\GH21495-PA | 223 | GH21495-PA | 1..222 | 1..219 | 379 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42Ea-PC | 226 | CG18817-PC | 1..226 | 1..226 | 1208 | 100 | Plus |
Tsp42Ea-PB | 226 | CG18817-PB | 1..226 | 1..226 | 1208 | 100 | Plus |
Tsp42Ea-PA | 226 | CG18817-PA | 1..226 | 1..226 | 1208 | 100 | Plus |
Tsp42Ed-PB | 227 | CG12846-PB | 1..227 | 1..226 | 530 | 41.9 | Plus |
Tsp42Ed-PA | 227 | CG12846-PA | 1..227 | 1..226 | 530 | 41.9 | Plus |
Tsp42Ee-PB | 228 | CG10106-PB | 1..228 | 1..226 | 519 | 45.2 | Plus |
Tsp42Ee-PA | 228 | CG10106-PA | 1..228 | 1..226 | 519 | 45.2 | Plus |
CG30160-PA | 222 | CG30160-PA | 1..220 | 1..218 | 454 | 39 | Plus |
Tsp42Eb-PB | 222 | CG18816-PB | 1..220 | 1..218 | 454 | 39 | Plus |
Tsp42Ec-PA | 232 | CG12847-PA | 1..223 | 1..219 | 354 | 34.4 | Plus |
Tsp42El-PA | 217 | CG12840-PA | 1..217 | 1..226 | 291 | 33.5 | Plus |
Tsp47F-PB | 239 | CG9033-PB | 3..239 | 2..223 | 286 | 32.4 | Plus |
Tsp39D-PB | 235 | CG8666-PB | 3..229 | 2..218 | 284 | 28.5 | Plus |
Tsp29Fa-PC | 248 | CG9494-PC | 11..239 | 8..218 | 267 | 30.9 | Plus |
Tsp29Fa-PB | 248 | CG9494-PB | 11..239 | 8..218 | 267 | 30.9 | Plus |
Tsp29Fa-PA | 248 | CG9494-PA | 11..239 | 8..218 | 267 | 30.9 | Plus |
Tsp42Ef-PA | 220 | CG12845-PA | 5..220 | 6..226 | 257 | 27.9 | Plus |
Tsp42Er-PA | 211 | CG12837-PA | 7..211 | 7..226 | 255 | 29.1 | Plus |
Tsp42Eh-PB | 231 | CG12844-PB | 1..229 | 1..226 | 254 | 27 | Plus |
Tsp42Ei-PB | 229 | CG12843-PB | 1..223 | 1..223 | 218 | 27.6 | Plus |
Tsp42Ei-PA | 229 | CG12843-PA | 1..223 | 1..223 | 218 | 27.6 | Plus |
Tsp42Eg-PA | 218 | CG12142-PA | 1..215 | 1..226 | 215 | 24.7 | Plus |
Tsp42Eq-PA | 219 | CG12832-PA | 1..218 | 1..226 | 215 | 24.7 | Plus |
Tsp96F-PC | 268 | CG6120-PC | 8..268 | 6..224 | 211 | 23.4 | Plus |
Tsp96F-PA | 268 | CG6120-PA | 8..268 | 6..224 | 211 | 23.4 | Plus |
Tsp96F-PB | 284 | CG6120-PB | 8..268 | 6..224 | 211 | 23.4 | Plus |
Tsp74F-PB | 236 | CG5492-PB | 7..235 | 1..217 | 184 | 24.2 | Plus |
Tsp74F-PA | 236 | CG5492-PA | 7..235 | 1..217 | 184 | 24.2 | Plus |
lbm-PB | 208 | CG2374-PB | 38..208 | 49..226 | 176 | 28.5 | Plus |
lbm-PA | 208 | CG2374-PA | 38..208 | 49..226 | 176 | 28.5 | Plus |
Tsp42Ek-PB | 215 | CG12841-PB | 1..151 | 1..160 | 176 | 31.1 | Plus |
Tsp42Ek-PA | 215 | CG12841-PA | 1..151 | 1..160 | 176 | 31.1 | Plus |
Tsp3A-PB | 304 | CG10742-PB | 43..301 | 8..223 | 169 | 24.8 | Plus |
Tsp3A-PA | 304 | CG10742-PA | 43..301 | 8..223 | 169 | 24.8 | Plus |
Tsp42En-PB | 218 | CG12839-PB | 1..218 | 1..226 | 168 | 23.5 | Plus |
Tsp42En-PA | 218 | CG12839-PA | 1..218 | 1..226 | 168 | 23.5 | Plus |
Tsp66E-PC | 267 | CG4999-PC | 5..262 | 3..220 | 165 | 22.5 | Plus |
Tsp66E-PA | 267 | CG4999-PA | 5..262 | 3..220 | 165 | 22.5 | Plus |
Tsp66E-PB | 267 | CG4999-PB | 5..262 | 3..220 | 165 | 22.5 | Plus |
Tsp86D-PB | 291 | CG4591-PB | 29..283 | 6..217 | 159 | 25.7 | Plus |
Tsp86D-PA | 291 | CG4591-PA | 29..283 | 6..217 | 159 | 25.7 | Plus |
Tsp86D-PC | 316 | CG4591-PC | 29..283 | 6..217 | 159 | 25.7 | Plus |
Tsp26A-PC | 277 | CG9093-PC | 19..262 | 8..210 | 153 | 23.8 | Plus |
Tsp29Fb-PC | 308 | CG9496-PC | 8..247 | 1..218 | 149 | 21.4 | Plus |
Tsp29Fb-PA | 308 | CG9496-PA | 8..247 | 1..218 | 149 | 21.4 | Plus |
Tsp29Fb-PB | 308 | CG9496-PB | 8..247 | 1..218 | 149 | 21.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19464-PA | 226 | GI19464-PA | 1..226 | 1..226 | 1073 | 87.6 | Plus |
Dmoj\GI19468-PA | 227 | GI19468-PA | 1..227 | 1..226 | 517 | 42.8 | Plus |
Dmoj\GI19469-PA | 231 | GI19469-PA | 1..231 | 1..226 | 491 | 45.5 | Plus |
Dmoj\GI19465-PA | 223 | GI19465-PA | 1..221 | 1..218 | 422 | 37.7 | Plus |
Dmoj\GI19466-PA | 230 | GI19466-PA | 1..225 | 1..219 | 375 | 34.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11133-PA | 226 | GL11133-PA | 1..226 | 1..226 | 1071 | 87.6 | Plus |
Dper\GL11136-PA | 227 | GL11136-PA | 1..227 | 1..226 | 505 | 43.7 | Plus |
Dper\GL11138-PA | 252 | GL11138-PA | 1..252 | 1..226 | 477 | 39.1 | Plus |
Dper\GL11135-PA | 229 | GL11135-PA | 1..219 | 1..218 | 362 | 34.8 | Plus |
Dper\GL10398-PA | 239 | GL10398-PA | 3..239 | 2..223 | 310 | 33.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15095-PA | 226 | GA15095-PA | 1..226 | 1..226 | 1071 | 87.6 | Plus |
Dpse\GA10076-PA | 228 | GA10076-PA | 1..228 | 1..226 | 513 | 43.2 | Plus |
Dpse\GA11851-PA | 227 | GA11851-PA | 1..227 | 1..226 | 507 | 43.7 | Plus |
Dpse\GA15688-PA | 223 | GA15688-PA | 1..221 | 1..218 | 416 | 41.3 | Plus |
Dpse\GA11852-PA | 229 | GA11852-PA | 1..219 | 1..218 | 360 | 34.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20912-PA | 226 | GM20912-PA | 1..226 | 1..226 | 1075 | 94.2 | Plus |
Dsec\GM20827-PA | 227 | GM20827-PA | 1..227 | 1..226 | 522 | 41.9 | Plus |
Dsec\GM16190-PA | 228 | GM16190-PA | 1..228 | 1..226 | 476 | 44.8 | Plus |
Dsec\GM18744-PA | 228 | GM18744-PA | 1..228 | 1..226 | 474 | 44.8 | Plus |
Dsec\GM20915-PA | 228 | GM20915-PA | 1..228 | 1..226 | 474 | 44.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10441-PA | 226 | GD10441-PA | 1..226 | 1..226 | 1082 | 94.7 | Plus |
Dsim\GD10280-PA | 227 | GD10280-PA | 1..227 | 1..226 | 523 | 41.9 | Plus |
Dsim\GD10444-PA | 228 | GD10444-PA | 1..228 | 1..226 | 489 | 45.7 | Plus |
Dsim\GD10442-PA | 222 | GD10442-PA | 1..220 | 1..218 | 440 | 39 | Plus |
Dsim\GD10443-PA | 232 | GD10443-PA | 1..223 | 1..219 | 352 | 35.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15124-PA | 226 | GJ15124-PA | 1..226 | 1..226 | 1079 | 88.5 | Plus |
Dvir\GJ15127-PA | 227 | GJ15127-PA | 1..227 | 1..226 | 524 | 43.7 | Plus |
Dvir\GJ15128-PA | 230 | GJ15128-PA | 1..230 | 1..226 | 466 | 44.4 | Plus |
Dvir\GJ15125-PA | 222 | GJ15125-PA | 1..220 | 1..218 | 386 | 40.4 | Plus |
Dvir\GJ15126-PA | 231 | GJ15126-PA | 21..221 | 21..218 | 324 | 35.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21771-PA | 226 | GK21771-PA | 1..226 | 1..226 | 1061 | 85 | Plus |
Dwil\GK21776-PA | 228 | GK21776-PA | 1..228 | 1..226 | 484 | 43.9 | Plus |
Dwil\GK21772-PA | 222 | GK21772-PA | 1..219 | 1..217 | 473 | 42.3 | Plus |
Dwil\GK21775-PA | 229 | GK21775-PA | 1..229 | 1..226 | 453 | 42.6 | Plus |
Dwil\GK21783-PA | 217 | GK21783-PA | 1..217 | 1..226 | 318 | 34.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19090-PA | 226 | GE19090-PA | 1..226 | 1..226 | 1084 | 94.7 | Plus |
Dyak\Tsp42Ed-PA | 227 | GE24279-PA | 1..227 | 1..226 | 523 | 42.4 | Plus |
Dyak\Tsp42Ee-PA | 228 | GE19093-PA | 1..228 | 1..226 | 483 | 46.1 | Plus |
Dyak\GE19091-PA | 222 | GE19091-PA | 1..221 | 1..219 | 436 | 38.4 | Plus |
Dyak\GE19092-PA | 232 | GE19092-PA | 1..223 | 1..219 | 359 | 34.2 | Plus |