BDGP Sequence Production Resources |
Search the DGRC for GH05731
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 57 |
Well: | 31 |
Vector: | pOT2 |
Associated Gene/Transcript | CG9689-RA |
Protein status: | GH05731.pep: gold |
Preliminary Size: | 856 |
Sequenced Size: | 705 |
Gene | Date | Evidence |
---|---|---|
CG9689 | 2001-01-01 | Release 2 assignment |
CG9689 | 2002-03-19 | Blastp of sequenced clone |
CG9689 | 2003-01-01 | Sim4 clustering to Release 3 |
CG9689 | 2008-04-29 | Release 5.5 accounting |
705 bp (705 high quality bases) assembled on 2002-03-19
GenBank Submission: AY094677
> GH05731.complete CGATACACGATATTCAAGATTTGAGATTCGAGATCCACAATTGCGATGAC TAATTCATTGACCATCGCCGTCTTTTTGGCCAGCCTGTGCCTCTTTGCCA GTTGTGGTCAAATGCAGGCAGCCTCCATTGTCTGCGGATCGGAGGCTAAG TCTGCAGAGGATGGTGATTCGGTGACCACTCCCAGTACCAGTGAGGTCAA CAAATTCGTCCACAGCCTGCAATGCACTCTGGAGAAGGCCAAGCCCTGGA TAGCCAATATCGAGAAGGAGGCCAAGATCTTGGAGGAGAAGGCCAGGGAT GCCACCATATCGCTCTTCCAGCGCATAAATAAACTGGTCAATGTGCTCGC CTCACCGGTTAAATTCGAAAAGGATAAGGAAAAGGATAAGGATGAGCAGA AGGAACCGGAGGAGGTCACCACCACGACCACCCCTTCCACATCGGAGGCT TCGAGTTCCTCCAAAAACGATCTTAAGGAGGAACTAACCACTTCTGCGCC GCCAGTTCACTTGGACTGGCTGGAGGATCATGCCAATGAGGTGGACTACA TTCCAGAGAAGAATTAGTGAAGCACTTAGTTAAGCACTATGCTAATATAT ATGTATACTAATTAATAAATTATGTTGCTCTTTATTCGATGAGCCTTTCC TATTTATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 9773689..9774346 | 1..658 | 3290 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 9881983..9882642 | 1..660 | 3300 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 9890081..9890740 | 1..660 | 3300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 9773689..9774346 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..522 | 46..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..522 | 46..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..522 | 46..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..522 | 46..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..522 | 46..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..658 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..658 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 31..688 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 1..658 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9689-RA | 31..688 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9881983..9882640 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9881983..9882640 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9881983..9882640 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 9776016..9776673 | 1..658 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 9890081..9890738 | 1..658 | 100 | Plus |
Translation from 45 to 566
> GH05731.hyp MTNSLTIAVFLASLCLFASCGQMQAASIVCGSEAKSAEDGDSVTTPSTSE VNKFVHSLQCTLEKAKPWIANIEKEAKILEEKARDATISLFQRINKLVNV LASPVKFEKDKEKDKDEQKEPEEVTTTTTPSTSEASSSSKNDLKEELTTS APPVHLDWLEDHANEVDYIPEKN*
Translation from 45 to 566
> GH05731.pep MTNSLTIAVFLASLCLFASCGQMQAASIVCGSEAKSAEDGDSVTTPSTSE VNKFVHSLQCTLEKAKPWIANIEKEAKILEEKARDATISLFQRINKLVNV LASPVKFEKDKEKDKDEQKEPEEVTTTTTPSTSEASSSSKNDLKEELTTS APPVHLDWLEDHANEVDYIPEKN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19139-PA | 169 | GF19139-PA | 1..166 | 1..171 | 478 | 64 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18330-PA | 177 | GG18330-PA | 1..176 | 1..172 | 644 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11808-PA | 168 | GH11808-PA | 2..104 | 1..99 | 226 | 43.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9689-PB | 173 | CG9689-PB | 1..173 | 1..173 | 878 | 100 | Plus |
CG9689-PA | 173 | CG9689-PA | 1..173 | 1..173 | 878 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15990-PA | 169 | GI15990-PA | 1..126 | 1..133 | 246 | 41.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16380-PA | 184 | GL16380-PA | 27..175 | 25..167 | 330 | 53.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22359-PA | 186 | GA22359-PA | 27..177 | 25..167 | 308 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11395-PA | 173 | GM11395-PA | 1..173 | 1..173 | 860 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11995-PA | 49 | GD11995-PA | 1..39 | 1..39 | 164 | 92.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18719-PA | 169 | GJ18719-PA | 3..103 | 1..105 | 222 | 43 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25362-PA | 183 | GK25362-PA | 10..114 | 1..99 | 212 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17816-PA | 175 | GE17816-PA | 1..175 | 1..173 | 738 | 90.9 | Plus |