Clone GH05836 Report

Search the DGRC for GH05836

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:58
Well:36
Vector:pOT2
Associated Gene/TranscriptCG10139-RA
Protein status:GH05836.pep: gold
Preliminary Size:810
Sequenced Size:816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10139 2001-01-01 Release 2 assignment
CG10139 2001-07-04 Blastp of sequenced clone
CG10139 2003-01-01 Sim4 clustering to Release 3
CG10139 2008-04-29 Release 5.5 accounting
CG10139 2008-08-15 Release 5.9 accounting
CG10139 2008-12-18 5.12 accounting

Clone Sequence Records

GH05836.complete Sequence

816 bp (816 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047545

> GH05836.complete
CATTGTTGCTGTACGTCGTGTTTTAATTAATTTCCATTGCGCTTTTTTGT
CGAATTATGAAAATTTACAAGCAGAAACTGCGCGATGTGTGGCTGCAAAT
GGAGGAGTTTCGTGCGTGGCTGCGGCGTGATCCGGACGACTCCTACCGGG
CGCACTGCCGCTTCTGCAAATGCTGCGTAAACACCAAAATAAGCGATCTG
CGTGCACATGCGTCGACCAAGAAGCATATGAAGCACTTAAACCTTAAACA
GCAAATCAAAACCACAGACGACAGCCCCTTAAACAGGTCATCCGCCAGCA
GCTCCAGCACCACTCCCTACAAGGTCAAGGTGAAGTCGCAGCCAAAAACT
TCCCCGGTAAAAAAGGAAAAAATCAGTGCATCGGATCAGTCCGTCGACTA
CGAGGAAATCATTGAGAACCTGGCACTTTACGAACCAGAGCAGGTCATGT
TCTCATCGTGCTCCCTGACCGGCGGCGGCGAGCAAAGGCTAGAGGACGAC
GTTGAAGGCGAGGGCGAGATGTCCACCATCAGCATTATGGACGAGGAAAT
GGTCAACAAGGCAGTGGCCAATGCTCTGCGCACCCAGAAGGACAGCTCCC
AGATCTTCGGAGACTTTGTGGCCGACCGGCTACGACAGTTGAACACCGAC
GCCTCCGAGTTTGCCAAGGACAAGATAATGAAGGTGATATTGGAGGCAGC
GTCCATCGATCGGGCTCCCACTTATAATTAAAATATTAGTTTTTAGTATT
GACTATAGTTTGAATAAAACATGAACTGTACAATTATGATTAATTAAAAA
AAAAAAAAAAAAAAAA

GH05836.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG10139-RA 1083 CG10139-RA 66..863 1..798 3990 100 Plus
CG10139.a 859 CG10139.a 78..801 75..798 3620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10532917..10533454 258..795 2690 100 Plus
chr2R 21145070 chr2R 10532603..10532859 1..257 1285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:33:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14645614..14646154 258..798 2705 100 Plus
2R 25286936 2R 14645300..14645556 1..257 1285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14646813..14647353 258..798 2705 100 Plus
2R 25260384 2R 14646499..14646755 1..257 1285 100 Plus
Blast to na_te.dros performed 2019-03-16 07:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
G6 2042 G6 G6_DM 2042bp 845..947 319..421 119 57.3 Plus

GH05836.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:15:01 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10532603..10532859 1..257 100 -> Plus
chr2R 10532917..10533454 258..795 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:19:17 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 1..675 57..731 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:03 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 1..675 57..731 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:43:52 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 1..675 57..731 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:43:57 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 1..675 57..731 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:07 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 1..675 57..731 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:15:21 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 30..824 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:03 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 30..824 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:52 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 31..825 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:43:58 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 30..824 1..795 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:07 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
CG10139-RA 31..825 1..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:15:01 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14645300..14645556 1..257 100 -> Plus
2R 14645614..14646151 258..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:15:01 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14645300..14645556 1..257 100 -> Plus
2R 14645614..14646151 258..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:15:01 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14645300..14645556 1..257 100 -> Plus
2R 14645614..14646151 258..795 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:52 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10532805..10533061 1..257 100 -> Plus
arm_2R 10533119..10533656 258..795 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:26:55 Download gff for GH05836.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14646499..14646755 1..257 100 -> Plus
2R 14646813..14647350 258..795 100   Plus

GH05836.pep Sequence

Translation from 56 to 730

> GH05836.pep
MKIYKQKLRDVWLQMEEFRAWLRRDPDDSYRAHCRFCKCCVNTKISDLRA
HASTKKHMKHLNLKQQIKTTDDSPLNRSSASSSSTTPYKVKVKSQPKTSP
VKKEKISASDQSVDYEEIIENLALYEPEQVMFSSCSLTGGGEQRLEDDVE
GEGEMSTISIMDEEMVNKAVANALRTQKDSSQIFGDFVADRLRQLNTDAS
EFAKDKIMKVILEAASIDRAPTYN*

GH05836.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17496-PA 223 GF17496-PA 1..223 1..224 754 65.4 Plus
Dana\GF10291-PA 198 GF10291-PA 5..60 3..58 200 57.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20471-PA 224 GG20471-PA 1..224 1..224 1097 93.3 Plus
Dere\GG23096-PA 72 GG23096-PA 6..61 4..59 171 50 Plus
Dere\GG14429-PA 96 GG14429-PA 3..76 2..75 145 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19472-PA 224 GH19472-PA 1..222 1..222 545 52.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG10139-PA 224 CG10139-PA 1..224 1..224 1149 100 Plus
CG10139-PB 210 CG10139-PB 1..210 15..224 1074 100 Plus
l(2)05714-PC 260 CG8886-PC 15..244 2..213 150 22.6 Plus
l(2)05714-PA 260 CG8886-PA 15..244 2..213 150 22.6 Plus
l(2)05714-PB 271 CG8886-PB 15..255 2..213 145 21.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22253-PA 225 GI22253-PA 1..225 1..224 529 52.5 Plus
Dmoj\GI22958-PA 152 GI22958-PA 4..80 2..75 206 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24003-PA 230 GL24003-PA 1..230 1..224 691 59.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26474-PA 230 GA26474-PA 1..230 1..224 684 60.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21563-PA 225 GM21563-PA 1..225 1..224 1170 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11068-PA 225 GD11068-PA 1..225 1..224 1172 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24044-PA 225 GJ24044-PA 1..225 1..224 558 53.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14367-PA 245 GK14367-PA 1..241 1..220 559 52.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13602-PA 224 GE13602-PA 1..224 1..224 1082 92 Plus

GH05836.hyp Sequence

Translation from 56 to 730

> GH05836.hyp
MKIYKQKLRDVWLQMEEFRAWLRRDPDDSYRAHCRFCKCCVNTKISDLRA
HASTKKHMKHLNLKQQIKTTDDSPLNRSSASSSSTTPYKVKVKSQPKTSP
VKKEKISASDQSVDYEEIIENLALYEPEQVMFSSCSLTGGGEQRLEDDVE
GEGEMSTISIMDEEMVNKAVANALRTQKDSSQIFGDFVADRLRQLNTDAS
EFAKDKIMKVILEAASIDRAPTYN*

GH05836.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10139-PA 224 CG10139-PA 1..224 1..224 1149 100 Plus
CG10139-PB 210 CG10139-PB 1..210 15..224 1074 100 Plus
l(2)05714-PC 260 CG8886-PC 15..244 2..213 150 22.6 Plus
l(2)05714-PA 260 CG8886-PA 15..244 2..213 150 22.6 Plus
l(2)05714-PB 271 CG8886-PB 15..255 2..213 145 21.8 Plus