Clone GH05862 Report

Search the DGRC for GH05862

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:58
Well:62
Vector:pOT2
Associated Gene/TranscriptNP15.6-RA
Protein status:GH05862.pep: gold
Preliminary Size:639
Sequenced Size:680

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6008 2001-01-01 Release 2 assignment
CG6008 2001-07-04 Blastp of sequenced clone
CG6008 2003-01-01 Sim4 clustering to Release 3
NP15.6 2008-04-29 Release 5.5 accounting
NP15.6 2008-08-15 Release 5.9 accounting
NP15.6 2008-12-18 5.12 accounting

Clone Sequence Records

GH05862.complete Sequence

680 bp (680 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047546

> GH05862.complete
TCAGAAGTCCAGCGATCAAGGGAAAACTCGATTATTTACGAAATTTGCGA
CTGAAATTTCTTCCCCAACGCGATGTCTGCGCTGTTCCGTCTGACCAACC
GCGCCGTGGCGCTGCAGCGTTCCCTGGTCGCCAACCAGGCGGCAGTGGTG
CGGGCAATCAACACGTCGCCGAAGAAGGATGAGACCATCACGGCCCCCAC
TTCACTTACGACCGAGGACTTTGCCAATCCGAGTCCCAAGAACTGGCAGA
GCTACGGATTCGACTACAAGGACCAGGTGGAGGATCGCAAGGCCACCAAG
TCGACGTTCTTCGTTACGGTGACACTGTGCCTGGTGTGGGGCAGCTTCTA
CTGGGCCTACCTGCCCGACACTCAGTTCCGCAACTGGGCCCAGCGTGAGG
GCTTCTTGGAGCTGCGTCGCCGCGAACTGGCCGGCGTGGATTTGGTCAGC
CCCAACTACGTGGACCCCGCCAGCATTACACTGCCCTCGGACGAGGATCT
GGGCGACACCGAGATCATCATCTAAACATTTAGTGACCCTAAACTTAGTC
TGTTATGTAATGCGAATGCGAAGTGCGGTCAGTGCGAGTCCGCTCATAAT
CCGTTAATAAATCTGCAAGTCTCGCCGTGGACACAGCTGCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH05862.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
NP15_6-RA 664 NP15_6-RA 25..664 1..640 3200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14851359..14851998 1..640 3185 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:33:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19027376..19028015 1..640 3200 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18768207..18768846 1..640 3200 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:53:58 has no hits.

GH05862.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:54:45 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14851359..14851998 1..640 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:19:23 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 1..453 73..525 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:29:29 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 1..453 73..525 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:16 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 1..453 73..525 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:56 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 1..453 73..525 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:50:19 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 1..453 73..525 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:29:56 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 25..664 1..640 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:29:29 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 25..664 1..640 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:16 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 25..664 1..640 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:56 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 25..664 1..640 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:50:19 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 9..648 1..640 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:45 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19027376..19028015 1..640 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:45 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19027376..19028015 1..640 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:45 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19027376..19028015 1..640 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:16 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14853098..14853737 1..640 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:40:55 Download gff for GH05862.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18768207..18768846 1..640 100   Plus

GH05862.hyp Sequence

Translation from 72 to 524

> GH05862.hyp
MSALFRLTNRAVALQRSLVANQAAVVRAINTSPKKDETITAPTSLTTEDF
ANPSPKNWQSYGFDYKDQVEDRKATKSTFFVTVTLCLVWGSFYWAYLPDT
QFRNWAQREGFLELRRRELAGVDLVSPNYVDPASITLPSDEDLGDTEIII
*

GH05862.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
NP15.6-PA 150 CG6008-PA 1..150 1..150 779 100 Plus

GH05862.pep Sequence

Translation from 72 to 524

> GH05862.pep
MSALFRLTNRAVALQRSLVANQAAVVRAINTSPKKDETITAPTSLTTEDF
ANPSPKNWQSYGFDYKDQVEDRKATKSTFFVTVTLCLVWGSFYWAYLPDT
QFRNWAQREGFLELRRRELAGVDLVSPNYVDPASITLPSDEDLGDTEIII
*

GH05862.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18594-PA 150 GF18594-PA 1..150 1..150 704 87.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23117-PA 150 GG23117-PA 1..150 1..150 771 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14310-PA 156 GH14310-PA 1..156 1..150 648 76.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
NP15.6-PA 150 CG6008-PA 1..150 1..150 779 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10408-PA 153 GI10408-PA 1..153 1..150 634 77.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13574-PA 153 GL13574-PA 1..153 1..150 686 85 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19291-PA 153 GA19291-PA 1..153 1..150 690 85 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23285-PA 150 GM23285-PA 1..150 1..150 768 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19265-PA 150 GD19265-PA 1..150 1..150 764 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14522-PA 153 GJ14522-PA 1..153 1..150 667 81 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13572-PA 154 GK13572-PA 1..154 1..150 647 79.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25576-PA 150 GE25576-PA 1..150 1..150 761 96 Plus