Clone GH05933 Report

Search the DGRC for GH05933

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:59
Well:33
Vector:pOT2
Associated Gene/TranscriptCG32488-RA
Protein status:GH05933.pep: gold
Preliminary Size:1178
Sequenced Size:1070

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2077 2001-01-01 Release 2 assignment
CG32488 2002-03-19 Blastp of sequenced clone
CG32488 2003-01-01 Sim4 clustering to Release 3
CG32488 2008-04-29 Release 5.5 accounting
CG32488 2008-08-15 Release 5.9 accounting
CG32488 2008-12-18 5.12 accounting

Clone Sequence Records

GH05933.complete Sequence

1070 bp (1070 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094679

> GH05933.complete
CTCCGATCCGATCGGGAAGCTATGTTCAAGCATACTTTCACAGATTTGAC
CAAGTTGCCGAAACAACGGGTTCGCCAATGGCTATCCACATTCGAATCCG
TGATCCTTGATGCCGATGGAGTCCTTTGGCACTTCTCGAAGGCAATTGAC
GGAGCTGTGGATACTTTCAATTACATGAACACCACCGGCCGAAAGATTTT
CATAATCTCTAACAATTCCGAGATTTCAAGGCAGGAGATGGCCGATAAGG
CGAAAGGTTTTGGCATAGAGATCAAGGAGGATAATGTACTGACTTCGTCC
TTTTCGTGTGCCAATTTCCTGGCTGTCAAAAACTTTCAGAAGAAGGTTTT
CGTCATGGGCGAGAAAGGAGTTCATTTTGAGCTGGAAAAATTTGGCATCT
GCTCCCTGAAAATGTCCGAAAAGCTGGAGAAGCCCATGCACGAGTTCGTC
ACTGAGTTGGAACTGGATCCCGATGTGGGAGCAGTAATTGTGGGCCGGGA
TGAGGGTTTCAACATGGCCAAGCTGGTTCGAACCGGCAGCTATCTGCTGA
ATCCCGATGTCATTTTTCTCGGCACCTGTTTAGATGCCGCCTATCCCATC
GGAAATAACCGGGTGATGGTGGGCGCCGGTGCCACCTTGGCGGCCATGAA
AGCCTATACCGGAAGGTCGCCGCTGGTGCTGGGAAAACCCAATCCCTGGA
TGGCGTCTACACTCATGCAGTCCGGGGCCATAAAGCCGGAAACCACACTA
ATGGTGGGCGATACACTGCAGACGGATATGCACTTCGCTTCCAACTGTGG
TTTCCAATCCCTGATGGTCGGCAGTGGTGTGAACACCCCGAAGGAAGTGC
AGCAGATCATCGAGGAGGGTGACCCCAAGAAGAAGATCCTGGTGCCAGAT
ACCTACCTTCCCAGCCTCGGCCACATGCTGGAGTTCCTCTGCTAGACCGC
ATACAAATTGTAAATTATTATTGGCAAAAAATTTTGCATAAAATCAATAC
CACAAAGGCCGCCTGCTACGGCCTGTCTTCAATGTCACCCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

GH05933.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32488.a 1245 CG32488.a 1..1045 1..1045 5210 99.9 Plus
CG32488-RA 1040 CG32488-RA 1..1040 1..1040 5200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3014692..3015455 764..1 3730 99.2 Minus
chr3L 24539361 chr3L 3014352..3014627 1040..765 1335 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:33:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3015306..3016069 764..1 3820 100 Minus
3L 28110227 3L 3014961..3015241 1045..765 1390 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3015306..3016069 764..1 3820 100 Minus
3L 28103327 3L 3014961..3015241 1045..765 1390 99.6 Minus
Blast to na_te.dros performed on 2019-03-16 17:54:02 has no hits.

GH05933.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:55:21 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3014352..3014627 765..1040 98 <- Minus
chr3L 3014692..3015455 1..764 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:19:35 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..924 22..945 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:52 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..924 22..945 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:03:16 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..924 22..945 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:56 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..924 22..945 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:49 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..924 22..945 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:50 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..1040 1..1040 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:52 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..1040 1..1040 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:03:16 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..1040 1..1040 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:56 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..1040 1..1040 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:49 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
CG32488-RA 1..1040 1..1040 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:21 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3014966..3015241 765..1040 100 <- Minus
3L 3015306..3016069 1..764 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:21 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3014966..3015241 765..1040 100 <- Minus
3L 3015306..3016069 1..764 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:21 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3014966..3015241 765..1040 100 <- Minus
3L 3015306..3016069 1..764 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:03:16 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3014966..3015241 765..1040 100 <- Minus
arm_3L 3015306..3016069 1..764 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:43 Download gff for GH05933.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3014966..3015241 765..1040 100 <- Minus
3L 3015306..3016069 1..764 100   Minus

GH05933.hyp Sequence

Translation from 1 to 944

> GH05933.hyp
LRSDREAMFKHTFTDLTKLPKQRVRQWLSTFESVILDADGVLWHFSKAID
GAVDTFNYMNTTGRKIFIISNNSEISRQEMADKAKGFGIEIKEDNVLTSS
FSCANFLAVKNFQKKVFVMGEKGVHFELEKFGICSLKMSEKLEKPMHEFV
TELELDPDVGAVIVGRDEGFNMAKLVRTGSYLLNPDVIFLGTCLDAAYPI
GNNRVMVGAGATLAAMKAYTGRSPLVLGKPNPWMASTLMQSGAIKPETTL
MVGDTLQTDMHFASNCGFQSLMVGSGVNTPKEVQQIIEEGDPKKKILVPD
TYLPSLGHMLEFLC*

GH05933.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32488-PB 307 CG32488-PB 1..307 8..314 1595 100 Plus
CG32488-PA 307 CG32488-PA 1..307 8..314 1595 100 Plus
CG5567-PA 330 CG5567-PA 16..319 8..310 610 39 Plus
CG11291-PA 308 CG11291-PA 1..307 8..314 604 39.3 Plus
CG32487-PA 320 CG32487-PA 19..315 19..313 564 39.7 Plus

GH05933.pep Sequence

Translation from 21 to 944

> GH05933.pep
MFKHTFTDLTKLPKQRVRQWLSTFESVILDADGVLWHFSKAIDGAVDTFN
YMNTTGRKIFIISNNSEISRQEMADKAKGFGIEIKEDNVLTSSFSCANFL
AVKNFQKKVFVMGEKGVHFELEKFGICSLKMSEKLEKPMHEFVTELELDP
DVGAVIVGRDEGFNMAKLVRTGSYLLNPDVIFLGTCLDAAYPIGNNRVMV
GAGATLAAMKAYTGRSPLVLGKPNPWMASTLMQSGAIKPETTLMVGDTLQ
TDMHFASNCGFQSLMVGSGVNTPKEVQQIIEEGDPKKKILVPDTYLPSLG
HMLEFLC*

GH05933.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10231-PA 308 GF10231-PA 1..307 1..306 926 56 Plus
Dana\GF25232-PA 316 GF25232-PA 1..303 1..302 608 37.2 Plus
Dana\GF10230-PA 309 GF10230-PA 16..290 9..285 571 40.9 Plus
Dana\GF12617-PA 318 GF12617-PA 1..305 1..307 495 34.5 Plus
Dana\GF25233-PA 315 GF25233-PA 9..315 9..306 415 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14490-PA 307 GG14490-PA 1..307 1..307 1522 91.2 Plus
Dere\GG22174-PA 314 GG22174-PA 1..307 1..307 642 40.9 Plus
Dere\GG15774-PA 315 GG15774-PA 1..304 1..303 632 39 Plus
Dere\GG14489-PA 320 GG14489-PA 19..315 12..306 591 39.1 Plus
Dere\GG15776-PA 315 GG15776-PA 1..315 1..306 424 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14576-PA 309 GH14576-PA 1..309 1..307 815 49.8 Plus
Dgri\GH14574-PA 319 GH14574-PA 8..314 2..306 674 43.3 Plus
Dgri\GH23184-PA 319 GH23184-PA 8..314 2..306 673 43.3 Plus
Dgri\GH14463-PA 316 GH14463-PA 1..307 1..306 619 39 Plus
Dgri\GH14464-PA 314 GH14464-PA 1..314 1..306 387 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32488-PB 307 CG32488-PB 1..307 1..307 1595 100 Plus
CG32488-PA 307 CG32488-PA 1..307 1..307 1595 100 Plus
CG5567-PA 330 CG5567-PA 16..319 1..303 610 39 Plus
CG11291-PA 308 CG11291-PA 1..307 1..307 604 39.3 Plus
CG32487-PA 320 CG32487-PA 19..315 12..306 564 39.7 Plus
CG5577-PB 315 CG5577-PB 8..315 8..306 410 35 Plus
CG5577-PA 315 CG5577-PA 8..315 8..306 410 35 Plus
CG15739-PB 308 CG15739-PB 7..300 9..306 294 24.7 Plus
CG15739-PA 308 CG15739-PA 7..300 9..306 294 24.7 Plus
CG2680-PB 305 CG2680-PB 7..300 9..306 249 26.2 Plus
CG10352-PB 315 CG10352-PB 7..298 9..302 244 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13900-PA 307 GI13900-PA 1..307 1..306 913 54.1 Plus
Dmoj\GI13899-PA 314 GI13899-PA 3..309 2..306 655 42.3 Plus
Dmoj\GI13608-PA 316 GI13608-PA 1..304 1..303 592 37 Plus
Dmoj\GI13609-PA 310 GI13609-PA 1..310 1..306 454 34.3 Plus
Dmoj\GI10972-PA 323 GI10972-PA 22..314 9..306 296 27 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13742-PA 308 GL13742-PA 1..308 1..307 967 56.8 Plus
Dper\GL16692-PA 317 GL16692-PA 1..306 1..305 948 56.2 Plus
Dper\GL18198-PA 305 GL18198-PA 1..305 1..307 943 56.2 Plus
Dper\GL17529-PA 336 GL17529-PA 1..308 1..307 790 49.4 Plus
Dper\GL22743-PA 314 GL22743-PA 4..309 2..306 593 38.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16942-PA 308 GA16942-PA 1..308 1..307 975 57.1 Plus
Dpse\GA24194-PA 336 GA24194-PA 1..308 1..307 785 49 Plus
Dpse\GA18976-PA 314 GA18976-PA 4..309 2..306 593 38.1 Plus
Dpse\GA16941-PA 321 GA16941-PA 25..316 17..306 580 40.1 Plus
Dpse\GA18982-PA 313 GA18982-PA 1..313 1..306 439 34.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14093-PA 307 GM14093-PA 1..307 1..307 1604 96.4 Plus
Dsec\GM24299-PA 315 GM24299-PA 1..304 1..303 630 39 Plus
Dsec\GM14092-PA 320 GM14092-PA 9..315 2..306 586 39.4 Plus
Dsec\GM24300-PA 315 GM24300-PA 1..315 1..306 414 33.6 Plus
Dsec\GM13116-PA 308 GM13116-PA 7..300 9..306 301 24 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13365-PA 307 GD13365-PA 1..307 1..307 1611 97.1 Plus
Dsim\GD12368-PA 315 GD12368-PA 1..304 1..303 630 39 Plus
Dsim\GD11653-PA 308 GD11653-PA 1..306 1..306 618 40.1 Plus
Dsim\GD13364-PA 320 GD13364-PA 9..315 2..306 589 39.4 Plus
Dsim\GD12369-PA 315 GD12369-PA 1..315 1..306 426 34.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11757-PA 308 GJ11757-PA 1..307 1..306 922 53.1 Plus
Dvir\GJ11756-PA 321 GJ11756-PA 10..316 2..306 621 42 Plus
Dvir\GJ13944-PA 316 GJ13944-PA 1..304 1..303 592 37.7 Plus
Dvir\GJ13945-PA 310 GJ13945-PA 1..310 1..306 442 33.6 Plus
Dvir\GJ18537-PA 304 GJ18537-PA 6..299 9..306 270 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17623-PA 311 GK17623-PA 1..311 1..307 995 57.9 Plus
Dwil\GK20804-PA 298 GK20804-PA 1..295 1..294 866 56.1 Plus
Dwil\GK16579-PA 323 GK16579-PA 17..318 9..306 634 41.4 Plus
Dwil\GK21181-PA 318 GK21181-PA 3..309 1..306 623 38.6 Plus
Dwil\GK10443-PA 313 GK10443-PA 1..313 1..306 413 31.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21679-PA 307 GE21679-PA 1..307 1..307 1530 91.2 Plus
Dyak\GE22109-PA 315 GE22109-PA 1..304 1..303 635 39.3 Plus
Dyak\GE14167-PA 311 GE14167-PA 1..306 1..306 631 40.4 Plus
Dyak\GE21678-PA 320 GE21678-PA 19..315 12..306 586 39.1 Plus
Dyak\GE22110-PA 315 GE22110-PA 1..315 1..306 418 34 Plus