Clone GH05949 Report

Search the DGRC for GH05949

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:59
Well:49
Vector:pOT2
Associated Gene/TranscriptCG17294-RA
Protein status:GH05949.pep: gold
Preliminary Size:992
Sequenced Size:1010

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17294 2001-01-01 Release 2 assignment
CG17294 2001-07-04 Blastp of sequenced clone
CG17294 2003-01-01 Sim4 clustering to Release 3
CG17294 2008-04-29 Release 5.5 accounting
CG17294 2008-08-15 Release 5.9 accounting
CG17294 2008-12-18 5.12 accounting

Clone Sequence Records

GH05949.complete Sequence

1010 bp (1010 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047550

> GH05949.complete
GAACGAGAAGCTTTCAACAGTTGAGAAAGATGTCTATTAAAGGAGCACTC
ATTGATCTCAGTGGCACCTTGCATGTGGAGGATGAACCTACTCCGAATGC
TGTCGAGGCGTTAAAAAGATTGCGTGACTCTGGCGTACTGGTGAAATTCG
TTACAAACACCACGAAGGATTCAAAGGCCACTCTTCACGAACGGCTATGC
AGGATTGGCTTCCAACTTGACGCCTCTGAGATCTACAGCTCCTTGAGTGC
CGCAGTCTCGTATGTGGAAAATGAGAGACTAAATCCGTACTATATTCTGT
CTGAGGATGCACGACAGGACTTTCCGCCGGAGGACACTAGGCGCTATAAG
GATTCAGTTGTAATCGGTCTGGCACCCAAGGCCTTTAACTATGAACAGCT
GAATGAGGCTTTTAACGTTCTATTGGAAAACAAGAATCACAAACTGATCG
CCGTGCATCAGGGTAAGTACTACAAACGAGCAGAAGGCCTAGCCTTGGGC
CCAGGGTGCTTTGTCAAGGGTTTGGAGTTCGCTACAGGACGAACTGCCAA
AGTGATTGGCAAGCCCAATCCTTATTTCTTCGAAGGAGCTCTGGCTGGTC
GGGATCCAGCCTCATGCGTTATGATTGGAGATGATGCCAATGATGACATA
GTGGGCGCCATGAGCATGGGCATGCAGGGAATTCTGGTCAAGACCGGCAA
ATATCTGCCGGATGTCAAACCATCCCCACCTCCAACAGCGTTGTTGGAAA
ACTTTGCAGAGGCTGTCGATTGGATTATACAGAAAAACCAATCTTAGGCT
TTATTGGGCTTCTGCAAATGTTTATCGTGTTTAAAACATAGATACTGACG
AATTTTTTATTTAAAATAGTTACTTAAAAAGACTTTACTGATATAGGTAA
GGCTTAGATATAATTAAATGCTCAAAATAAGTTCAGTTCTGATTATAAAC
TTTTCATGTGGAACATAATAAAGGACCCGTTTTTAAAGTGTGAAAAAAAA
AAAAAAAAAA

GH05949.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17294-RA 1075 CG17294-RA 57..1050 1..994 4970 100 Plus
Aats-ala-RA 3305 Aats-ala-RA 3249..3305 994..938 285 100 Minus
Aats-ala.a 3373 Aats-ala.a 3317..3373 994..938 285 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8376758..8377117 633..992 1800 100 Plus
chr2L 23010047 chr2L 8376134..8376432 117..415 1495 100 Plus
chr2L 23010047 chr2L 8376488..8376705 416..633 1090 100 Plus
chr2L 23010047 chr2L 8375966..8376083 1..118 590 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8377847..8378208 633..994 1810 100 Plus
2L 23513712 2L 8377223..8377521 117..415 1495 100 Plus
2L 23513712 2L 8377577..8377794 416..633 1090 100 Plus
2L 23513712 2L 8377055..8377172 1..118 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8377847..8378208 633..994 1810 100 Plus
2L 23513712 2L 8377223..8377521 117..415 1495 100 Plus
2L 23513712 2L 8377577..8377794 416..633 1090 100 Plus
2L 23513712 2L 8377055..8377172 1..118 590 100 Plus
Blast to na_te.dros performed 2019-03-15 15:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
opus 7521 opus OPUS 7521bp 4019..4114 87..179 132 63.3 Plus

GH05949.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:39:43 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8376136..8376432 119..415 100 -> Plus
chr2L 8376488..8376704 416..632 100 -> Plus
chr2L 8375966..8376083 1..118 100 -> Plus
chr2L 8376758..8377117 633..992 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:19:40 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 1..768 30..797 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:29:33 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 1..768 30..797 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:24 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 1..768 30..797 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:59 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 1..768 30..797 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:00 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 1..768 30..797 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:30:01 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 5..996 1..992 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:29:33 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 5..996 1..992 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:24 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 21..1012 1..992 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:03:00 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 5..996 1..992 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:00 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
CG17294-RA 21..1012 1..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:43 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8377055..8377172 1..118 100 -> Plus
2L 8377225..8377521 119..415 100 -> Plus
2L 8377577..8377793 416..632 100 -> Plus
2L 8377847..8378206 633..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:43 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8377055..8377172 1..118 100 -> Plus
2L 8377225..8377521 119..415 100 -> Plus
2L 8377577..8377793 416..632 100 -> Plus
2L 8377847..8378206 633..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:43 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8377055..8377172 1..118 100 -> Plus
2L 8377225..8377521 119..415 100 -> Plus
2L 8377577..8377793 416..632 100 -> Plus
2L 8377847..8378206 633..992 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:24 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8377225..8377521 119..415 100 -> Plus
arm_2L 8377577..8377793 416..632 100 -> Plus
arm_2L 8377055..8377172 1..118 100 -> Plus
arm_2L 8377847..8378206 633..992 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:40:59 Download gff for GH05949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8377577..8377793 416..632 100 -> Plus
2L 8377225..8377521 119..415 100 -> Plus
2L 8377847..8378206 633..992 100   Plus
2L 8377055..8377172 1..118 100 -> Plus

GH05949.hyp Sequence

Translation from 2 to 796

> GH05949.hyp
TRSFQQLRKMSIKGALIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFV
TNTTKDSKATLHERLCRIGFQLDASEIYSSLSAAVSYVENERLNPYYILS
EDARQDFPPEDTRRYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIA
VHQGKYYKRAEGLALGPGCFVKGLEFATGRTAKVIGKPNPYFFEGALAGR
DPASCVMIGDDANDDIVGAMSMGMQGILVKTGKYLPDVKPSPPPTALLEN
FAEAVDWIIQKNQS*

GH05949.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17294-PA 255 CG17294-PA 1..255 10..264 1318 100 Plus
CG5577-PB 315 CG5577-PB 23..292 11..239 163 27.3 Plus
CG5577-PA 315 CG5577-PA 23..292 11..239 163 27.3 Plus

GH05949.pep Sequence

Translation from 29 to 796

> GH05949.pep
MSIKGALIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKA
TLHERLCRIGFQLDASEIYSSLSAAVSYVENERLNPYYILSEDARQDFPP
EDTRRYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKR
AEGLALGPGCFVKGLEFATGRTAKVIGKPNPYFFEGALAGRDPASCVMIG
DDANDDIVGAMSMGMQGILVKTGKYLPDVKPSPPPTALLENFAEAVDWII
QKNQS*

GH05949.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15224-PA 255 GF15224-PA 1..253 1..253 1149 82.2 Plus
Dana\GF25233-PA 315 GF25233-PA 23..285 2..225 168 26.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10543-PA 255 GG10543-PA 1..255 1..255 1322 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10842-PA 258 GH10842-PA 1..258 1..255 997 71.7 Plus
Dgri\GH14576-PA 309 GH14576-PA 23..271 2..223 170 25.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17294-PA 255 CG17294-PA 1..255 1..255 1318 100 Plus
CG5577-PB 315 CG5577-PB 23..292 2..230 163 27.3 Plus
CG5577-PA 315 CG5577-PA 23..292 2..230 163 27.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17355-PA 257 GI17355-PA 1..257 1..254 959 68.9 Plus
Dmoj\GI13609-PA 310 GI13609-PA 30..282 9..225 187 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25939-PA 255 GL25939-PA 1..255 1..255 1154 82.4 Plus
Dper\GL22743-PA 314 GL22743-PA 29..280 6..230 202 28.7 Plus
Dper\GL22744-PA 297 GL22744-PA 16..273 11..229 164 26 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14446-PA 255 GA14446-PA 1..255 1..255 1154 82.4 Plus
Dpse\GA18976-PA 314 GA18976-PA 29..280 6..230 202 28.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16922-PA 255 GM16922-PA 1..255 1..255 1347 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23533-PA 255 GD23533-PA 1..255 1..255 1338 98.4 Plus
Dsim\GD12369-PA 315 GD12369-PA 23..292 2..230 169 26.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18029-PA 259 GJ18029-PA 1..257 1..254 1023 73.9 Plus
Dvir\GJ13944-PA 316 GJ13944-PA 23..278 2..230 201 26.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24162-PA 256 GK24162-PA 1..253 1..253 1138 80.6 Plus
Dwil\GK10443-PA 313 GK10443-PA 23..289 2..229 178 26.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18764-PA 255 GE18764-PA 1..255 1..255 1314 96.1 Plus