Clone GH05991 Report

Search the DGRC for GH05991

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:59
Well:91
Vector:pOT2
Associated Gene/TranscriptCG9106-RA
Protein status:GH05991.pep: gold
Preliminary Size:1415
Sequenced Size:1259

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9106 2001-01-01 Release 2 assignment
CG9106 2001-09-19 Blastp of sequenced clone
CG9106 2003-01-01 Sim4 clustering to Release 3
CG9106 2008-04-29 Release 5.5 accounting
CG9106 2008-08-15 Release 5.9 accounting
CG9106 2008-12-18 5.12 accounting

Clone Sequence Records

GH05991.complete Sequence

1259 bp (1259 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060241

> GH05991.complete
ACACAATCGACACAAAATACACACACACCGTTTAAACAAAAGTGAAAAAA
AATAGAGGAAAATCGAAAAAAAAAAGAATCAAACAGCGAAACAAAAATCA
TAACTTGGTATTGTATCTAGCTAATTAGAGAGTTGCACTAGAATCGCGTG
CGACTTGAACGTCGAGAAGTGTATAACAGATCCCTAAGCAGCACATCACT
GCACCAGAGTCTCATTGGATCGCACCGAGCAAAGTACAAAATTCGTAGGT
TCAAAGTTCAAAGTTTACGGTTTCCGAAGGACTAACCGAGAATCCAACCA
CGGACCATCCCGTCCAGAAGGCCAAAGGTAGCAACCAGCAACGAAGCTTC
AGTATTGAGCCACTTTGATAACTGCTTCCAATCCGATTTCTTTTCCACTT
TTGATAGTTTTATATTCAGATATCCCGAACCGCTGCCCTTCCAGGATGGT
CATCAATCTGAATCCGTCCACCTCTTCGAACGCCAATGCCAGCGGTAGCA
GCGTGGGTGGCGGCAGCGGTGGCGGCAGCGACGGTGGCAACGGCGATGGA
ATGAGCAGCGCTGGGAGCCAGAGCGGCAACATCATTGGCGGAAACGGAAG
CGGAAGCGGAAACGGTAACGGTAACGGTGATGGTAACGGTAGTGGCAACA
CCGCCGGAAACGTCAGTAGCGGCACCCCCAGCAACCTGATGGGCATCATC
AGCCATGAGATGTTCGATGGTATCGTCTATCTGCATGTGGTATGTGCCGG
TGAGTCAAGCTCCAAGTGGGTCACTCTGGAGGAGGCGATGGCCTACTGTC
CCAGCGGCGTTGTTGCCTACACCAAACTGCAGCTGGCCGAGATTTATGGC
ATACCGATGGACGTTCTGTTCGACTGATGGTGATGCATAAACCAGATTCT
TCGTTGAAGCGATTGCAGTGTACCGCACATGGACGATGGTTTTGATGGAT
TCTTGATTAGCTCCGTTTGGCTTGTACGGTTTATAAGCTGGACCATGGCA
ACTGTCATTTGAACTTTGGCACTGTTGGCAAAATCTAGGAATTCAGTATT
CGCCAAATACGTGGCATTGGCAATATAACGTCGATTGTTTTTTCTTGCTA
CATTCCCTGCTCTAAATTTTAAGTTCCTGGCGTTAAGTGATTTTTCCGAA
GGCAGCAATTACTAGAAATAGTATACGAATCTGCAAGGTTATTCCGTAAT
TAATTGCAAAAAAATAAAAAAAAATAATAATAAAATAAAGGAAAAAAAAA
AAAAAAAAA

GH05991.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9106-RA 1266 CG9106-RA 27..1266 1..1241 6165 99.9 Plus
CG9106-RB 864 CG9106-RB 42..864 418..1241 4080 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15160974..15161796 1241..418 4055 99.8 Minus
chrX 22417052 chrX 15161925..15162342 419..1 2015 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15271033..15271858 1244..418 4085 99.9 Minus
X 23542271 X 15271987..15272405 419..1 2095 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15279131..15279956 1244..418 4095 99.8 Minus
X 23527363 X 15280085..15280503 419..1 2095 100 Minus
Blast to na_te.dros performed 2019-03-15 23:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 620..717 609..509 165 64.4 Minus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 824..882 2..60 142 71.2 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1124..1189 1..61 129 73.1 Plus
TART-A 13424 TART-A 13424bp 11098..11129 490..521 115 84.4 Plus

GH05991.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:39:24 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15161009..15161541 673..1205 99 == Minus
chrX 15161722..15161794 420..492 100 <- Minus
chrX 15161925..15162342 1..419 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:19:44 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RB 1..432 446..877 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:09:38 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RB 1..432 446..877 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:41 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RA 1..432 446..877 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:40:34 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RB 1..432 446..877 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:44:04 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RA 1..432 446..877 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:00:39 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RA 1..1240 1..1241 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:09:38 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RA 1..1240 1..1241 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:41 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RA 1..1240 1..1241 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:40:34 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RA 1..1240 1..1241 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:44:04 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
CG9106-RA 1..1240 1..1241 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:39:24 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
X 15271036..15271856 420..1241 99 <- Minus
X 15271987..15272405 1..419 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:39:24 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
X 15271036..15271856 420..1241 99 <- Minus
X 15271987..15272405 1..419 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:39:24 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
X 15271036..15271856 420..1241 99 <- Minus
X 15271987..15272405 1..419 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:41 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15165069..15165889 420..1241 99 <- Minus
arm_X 15166020..15166438 1..419 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:18:06 Download gff for GH05991.complete
Subject Subject Range Query Range Percent Splice Strand
X 15279134..15279954 420..1241 99 <- Minus
X 15280085..15280503 1..419 100   Minus

GH05991.pep Sequence

Translation from 445 to 876

> GH05991.pep
MVINLNPSTSSNANASGSSVGGGSGGGSDGGNGDGMSSAGSQSGNIIGGN
GSGSGNGNGNGDGNGSGNTAGNVSSGTPSNLMGIISHEMFDGIVYLHVVC
AGESSSKWVTLEEAMAYCPSGVVAYTKLQLAEIYGIPMDVLFD*

GH05991.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21046-PA 150 GF21046-PA 1..150 1..142 337 54.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19409-PA 136 GG19409-PA 63..136 70..143 324 77 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24304-PA 66 GH24304-PA 1..58 82..139 158 37.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9106-PB 143 CG9106-PB 1..143 1..143 747 100 Plus
CG9106-PA 143 CG9106-PA 1..143 1..143 747 100 Plus
Cpr11A-PA 270 CG2560-PA 192..265 8..81 144 45.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21546-PA 93 GI21546-PA 3..93 39..143 225 42.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15990-PA 118 GL15990-PA 1..113 1..139 159 40.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21546-PA 118 GA21546-PA 1..113 1..139 157 39.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13383-PA 133 GM13383-PA 59..133 69..143 366 90.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15692-PA 85 GJ15692-PA 20..85 82..143 208 56.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16195-PA 110 GK16195-PA 45..107 80..142 257 66.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16057-PA 143 GE16057-PA 76..143 76..143 308 79.4 Plus

GH05991.hyp Sequence

Translation from 445 to 876

> GH05991.hyp
MVINLNPSTSSNANASGSSVGGGSGGGSDGGNGDGMSSAGSQSGNIIGGN
GSGSGNGNGNGDGNGSGNTAGNVSSGTPSNLMGIISHEMFDGIVYLHVVC
AGESSSKWVTLEEAMAYCPSGVVAYTKLQLAEIYGIPMDVLFD*

GH05991.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9106-PB 143 CG9106-PB 1..143 1..143 747 100 Plus
CG9106-PA 143 CG9106-PA 1..143 1..143 747 100 Plus
Cpr11A-PA 270 CG2560-PA 192..265 8..81 144 45.3 Plus