Clone GH06023 Report

Search the DGRC for GH06023

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:60
Well:23
Vector:pOT2
Associated Gene/TranscriptRpp30-RA
Protein status:GH06023.pep: gold
Preliminary Size:1300
Sequenced Size:945

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11606 2001-01-01 Release 2 assignment
CG11606 2003-01-01 Sim4 clustering to Release 3
CG11606 2003-02-17 Blastp of sequenced clone
Rpp30 2008-04-29 Release 5.5 accounting
Rpp30 2008-08-15 Release 5.9 accounting
Rpp30 2008-12-18 5.12 accounting

Clone Sequence Records

GH06023.complete Sequence

945 bp (945 high quality bases) assembled on 2003-02-17

GenBank Submission: AY075315

> GH06023.complete
AAATGGAGCAAACAAGGCCATTTTACGATTTCAGCATACCATACAACAAG
GACGACTCCGTGTTGCGGGCCCTGCTTAACGAGCTGGTGGAAACGGGCTA
CAAAACAGTGGCCATCGACCAGAGTTTCGACCACAGCAAAAAGGATCCGG
GCAAACGTGGGTCCGAGATGTTTCCCGAGCCTCATAAGATCGAGCATCTG
CGCAAGGAGTTCCAGGACAAGCTGAGAATCCTGCAGAGAATCACCATTCT
CTACGTAGACGTCAATGTGGCCCACGCGATGAGTGTCTCCCATAATCTGC
GGAAGTTCAATCTCATCGCTGGCCAACCGAAAACAGATGCCGCCCTGACG
CACTGCTGCACTGCCTTCAATGGGGACTTGATAACTTTTGATCCTGTGGC
TGGGTCCCGACTCTTGGTAAACCGAAAAGCATACCAGGTGGCAGTCCGTC
GGGGCATGTTCTTCGAAATTAAATACGCTCCATCTATCTGCGATTCGAAT
AACAGGAAGGACATGATAAAGATCGCCCAGAACTATTGCACCAAAGGGAA
GTCCAAGAACGTTATCTTCAGCAGTGGTGCGGCGCACGAATTCCAGCTGA
GAGGACCTTACGACGTTGCTAATTTGGCCTTTATCTTCGGCCTATCAGAG
GACCAAGGGAAAAATGCTGTGGACGGGCACTGCCGGGAACTTTTCCTGAA
GGCTGAGGCGCGTCGTCTGGGAAAAACCATCATGTTTCTCAAAGGAAACG
GTCCCATAATATACTCGGATAGCTCTGAGGACGAGAAAAGCACCGAAGAC
GAAATGAAGGGTCTAAAACCGCAAATTGGAAAAGCGGATGCATTTGAAGT
CAAAGACGGAACTGAGCACGCTATTAAACGACTTAAAGTGGCGTAGCCTT
TAACTAAAATACATCAGCTTTTTTAATAAAAAAAAAAAAAAAAAA

GH06023.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp30-RA 1143 Rpp30-RA 109..1037 1..929 4645 100 Plus
Rpp30.a 985 Rpp30.a 57..681 1..625 3125 100 Plus
Rpp30.a 985 Rpp30.a 682..962 649..929 1405 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 251195..251496 927..626 1510 100 Minus
chr2L 23010047 chr2L 251558..251834 626..350 1385 100 Minus
chr2L 23010047 chr2L 252011..252198 281..94 940 100 Minus
chr2L 23010047 chr2L 252259..252351 93..1 465 100 Minus
chr2L 23010047 chr2L 251888..251957 350..281 350 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 251161..251464 929..626 1520 100 Minus
2L 23513712 2L 251526..251802 626..350 1385 100 Minus
2L 23513712 2L 251979..252166 281..94 940 100 Minus
2L 23513712 2L 252227..252319 93..1 465 100 Minus
2L 23513712 2L 251856..251925 350..281 350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 251161..251464 929..626 1520 100 Minus
2L 23513712 2L 251526..251802 626..350 1385 100 Minus
2L 23513712 2L 251979..252166 281..94 940 100 Minus
2L 23513712 2L 252227..252319 93..1 465 100 Minus
2L 23513712 2L 251856..251925 350..281 350 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:33:52 has no hits.

GH06023.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:34:48 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 251888..251956 282..350 100 <- Minus
chr2L 252011..252198 94..281 100 <- Minus
chr2L 252259..252351 1..93 100   Minus
chr2L 251195..251496 626..927 100 <- Minus
chr2L 251559..251833 351..625 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:19:49 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 1..894 3..896 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:50:28 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 1..894 3..896 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:42 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 1..894 3..896 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:41:41 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 1..894 3..896 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:03:45 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 1..894 3..896 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:03:34 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 13..939 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:50:28 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 13..939 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:42 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 55..981 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:41:41 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 13..939 1..927 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:03:45 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp30-RA 55..981 1..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:48 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
2L 251979..252166 94..281 100 <- Minus
2L 252227..252319 1..93 100   Minus
2L 251163..251464 626..927 100 <- Minus
2L 251527..251801 351..625 100 <- Minus
2L 251856..251924 282..350 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:48 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
2L 251979..252166 94..281 100 <- Minus
2L 252227..252319 1..93 100   Minus
2L 251163..251464 626..927 100 <- Minus
2L 251527..251801 351..625 100 <- Minus
2L 251856..251924 282..350 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:48 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
2L 251979..252166 94..281 100 <- Minus
2L 252227..252319 1..93 100   Minus
2L 251163..251464 626..927 100 <- Minus
2L 251527..251801 351..625 100 <- Minus
2L 251856..251924 282..350 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:42 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 251163..251464 626..927 100 <- Minus
arm_2L 251527..251801 351..625 100 <- Minus
arm_2L 251856..251924 282..350 100 <- Minus
arm_2L 251979..252166 94..281 100 <- Minus
arm_2L 252227..252319 1..93 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:12:16 Download gff for GH06023.complete
Subject Subject Range Query Range Percent Splice Strand
2L 251163..251464 626..927 100 <- Minus
2L 251527..251801 351..625 100 <- Minus
2L 251856..251924 282..350 100 <- Minus
2L 251979..252166 94..281 100 <- Minus
2L 252227..252319 1..93 100   Minus

GH06023.hyp Sequence

Translation from 2 to 895

> GH06023.hyp
MEQTRPFYDFSIPYNKDDSVLRALLNELVETGYKTVAIDQSFDHSKKDPG
KRGSEMFPEPHKIEHLRKEFQDKLRILQRITILYVDVNVAHAMSVSHNLR
KFNLIAGQPKTDAALTHCCTAFNGDLITFDPVAGSRLLVNRKAYQVAVRR
GMFFEIKYAPSICDSNNRKDMIKIAQNYCTKGKSKNVIFSSGAAHEFQLR
GPYDVANLAFIFGLSEDQGKNAVDGHCRELFLKAEARRLGKTIMFLKGNG
PIIYSDSSEDEKSTEDEMKGLKPQIGKADAFEVKDGTEHAIKRLKVA*

GH06023.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp30-PB 297 CG11606-PB 1..297 1..297 1543 100 Plus
Rpp30-PA 297 CG11606-PA 1..297 1..297 1543 100 Plus

GH06023.pep Sequence

Translation from 2 to 895

> GH06023.pep
MEQTRPFYDFSIPYNKDDSVLRALLNELVETGYKTVAIDQSFDHSKKDPG
KRGSEMFPEPHKIEHLRKEFQDKLRILQRITILYVDVNVAHAMSVSHNLR
KFNLIAGQPKTDAALTHCCTAFNGDLITFDPVAGSRLLVNRKAYQVAVRR
GMFFEIKYAPSICDSNNRKDMIKIAQNYCTKGKSKNVIFSSGAAHEFQLR
GPYDVANLAFIFGLSEDQGKNAVDGHCRELFLKAEARRLGKTIMFLKGNG
PIIYSDSSEDEKSTEDEMKGLKPQIGKADAFEVKDGTEHAIKRLKVA*

GH06023.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24493-PA 289 GF24493-PA 1..288 1..296 1291 81.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24670-PA 290 GG24670-PA 1..290 1..297 1421 88.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10227-PA 289 GH10227-PA 1..289 1..297 1171 76.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp30-PB 297 CG11606-PB 1..297 1..297 1543 100 Plus
Rpp30-PA 297 CG11606-PA 1..297 1..297 1543 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15104-PA 297 GI15104-PA 1..297 1..297 1166 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25831-PA 296 GL25831-PA 1..296 1..297 1240 77.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11094-PA 296 GA11094-PA 1..296 1..297 1244 77.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16689-PA 298 GM16689-PA 1..298 1..297 1523 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22976-PA 298 GD22976-PA 1..298 1..297 1525 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17249-PA 297 GJ17249-PA 1..297 1..297 1253 77.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18180-PA 287 GK18180-PA 1..266 1..266 1213 81.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16338-PA 298 GE16338-PA 1..298 1..297 1453 89.6 Plus