Clone GH06291 Report

Search the DGRC for GH06291

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:62
Well:91
Vector:pOT2
Associated Gene/Transcriptbaf-RA
Protein status:GH06291.pep: gold
Sequenced Size:586

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7380 2003-01-01 Sim4 clustering to Release 3
CG7380 2004-01-31 Blastp of sequenced clone
baf 2008-04-29 Release 5.5 accounting
baf 2008-08-15 Release 5.9 accounting
baf 2008-12-18 5.12 accounting

Clone Sequence Records

GH06291.complete Sequence

586 bp (586 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011552

> GH06291.complete
ATTTTGCCATTGAAATCTAGCTAAGCATTGGAATTTCGCAACGTGCAGCA
GCAAAGCAAACTACAAACATGTCGGGCACATCGCAGAAACACAGGAACTT
CGTTGCGGAGCCAATGGGCAACAAGTCGGTGACGGAACTGGCCGGAATTG
GGGAAACCCTCGGTGGACGCTTGAAGGACGCTGGATTCGATATGGCCTAC
ACCGTTTTGGGACAGTATCTGGTGCTGAAAAAGGACGAGGAGCTGTTCAA
GGACTGGATGAAGGAGGTGTGCCACGCCAGCTCCAAACAGGCATCCGATT
GCTACAACTGTCTCAACGATTGGTGCGAGGAGTTCTTGTAAGAGGTGGAC
ACACAAGCCATCCGAGTAATTCGATCAAAAGGAATCTGCTAAAGGCATCG
GCCAATCATTTTTATTCGCAGTCAACGAAAGTGGCCCAATGCTAGCTAAG
CATTTGCCGTGTTCACTGTTAGTATGTATAGCTGTAGGGTGTAATTTAAT
GTCTAATCCGAATAAATGTACAGTCATGGAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH06291.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
baf-RA 876 baf-RA 162..693 1..532 2660 100 Plus
baf.a 1129 baf.a 162..693 1..532 2660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8028806..8029141 194..529 1680 100 Plus
chr2L 23010047 chr2L 8028531..8028725 1..195 960 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8029815..8030153 194..532 1695 100 Plus
2L 23513712 2L 8029540..8029734 1..195 975 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8029815..8030153 194..532 1695 100 Plus
2L 23513712 2L 8029540..8029734 1..195 975 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:44:12 has no hits.

GH06291.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:45:05 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8028531..8028724 1..194 99 -> Plus
chr2L 8028807..8029141 195..529 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:20:20 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 1..273 69..341 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:53 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 1..273 69..341 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:38:02 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 1..273 69..341 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:44 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 1..273 69..341 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:04 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 1..273 69..341 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:50:00 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 77..605 1..529 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:53 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 77..605 1..529 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:38:02 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 79..607 1..529 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:44 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 77..605 1..529 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:04 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 79..607 1..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:05 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8029540..8029733 1..194 100 -> Plus
2L 8029816..8030150 195..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:05 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8029540..8029733 1..194 100 -> Plus
2L 8029816..8030150 195..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:05 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8029540..8029733 1..194 100 -> Plus
2L 8029816..8030150 195..529 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:38:02 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8029540..8029733 1..194 100 -> Plus
arm_2L 8029816..8030150 195..529 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:08 Download gff for GH06291.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8029816..8030150 195..529 100   Plus
2L 8029540..8029733 1..194 100 -> Plus

GH06291.hyp Sequence

Translation from 68 to 340

> GH06291.hyp
MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQY
LVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL*

GH06291.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
baf-PB 90 CG7380-PB 1..90 1..90 487 100 Plus
baf-PA 90 CG7380-PA 1..90 1..90 487 100 Plus

GH06291.pep Sequence

Translation from 68 to 340

> GH06291.pep
MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQY
LVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL*

GH06291.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14573-PA 90 GF14573-PA 1..90 1..90 443 91.1 Plus
Dana\GF21700-PA 90 GF21700-PA 1..90 1..90 443 91.1 Plus
Dana\GF10876-PA 92 GF10876-PA 1..89 1..89 234 47.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10507-PA 90 GG10507-PA 1..90 1..90 461 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11610-PA 90 GH11610-PA 1..90 1..90 442 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
baf-PB 90 CG7380-PB 1..90 1..90 487 100 Plus
baf-PA 90 CG7380-PA 1..90 1..90 487 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17914-PA 90 GI17914-PA 1..90 1..90 443 90 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18737-PA 90 GL18737-PA 1..90 1..90 453 93.3 Plus
Dper\GL13018-PA 90 GL13018-PA 1..90 1..90 450 93.3 Plus
Dper\GL13017-PA 90 GL13017-PA 1..90 1..90 447 92.2 Plus
Dper\GL19718-PA 90 GL19718-PA 1..90 1..90 349 73.3 Plus
Dper\GL19731-PA 72 GL19731-PA 1..72 1..90 190 46.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25869-PA 90 GA25869-PA 1..90 1..90 457 94.4 Plus
Dpse\GA25775-PA 90 GA25775-PA 1..90 1..90 453 93.3 Plus
Dpse\GA25866-PA 90 GA25866-PA 1..90 1..90 448 93.3 Plus
Dpse\GA25862-PA 90 GA25862-PA 1..90 1..90 431 90 Plus
Dpse\GA28943-PA 90 GA28943-PA 1..90 1..90 326 70 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16676-PA 90 GM16676-PA 1..90 1..90 480 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23498-PA 90 GD23498-PA 1..90 1..90 480 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17685-PA 90 GJ17685-PA 1..90 1..90 444 91.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24369-PA 90 GK24369-PA 1..90 1..90 446 91.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18728-PA 90 GE18728-PA 1..90 1..90 464 96.7 Plus