Clone GH06388 Report

Search the DGRC for GH06388

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:63
Well:88
Vector:pOT2
Associated Gene/TranscriptCG4716-RA
Protein status:GH06388.pep: gold
Preliminary Size:941
Sequenced Size:803

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4716 2001-01-01 Release 2 assignment
CG4716 2002-07-13 Blastp of sequenced clone
CG4716 2008-04-29 Release 5.5 accounting
CG4716 2008-08-15 Release 5.9 accounting
CG4716 2008-12-18 5.12 accounting

Clone Sequence Records

GH06388.complete Sequence

803 bp (803 high quality bases) assembled on 2002-07-13

GenBank Submission: BT001399

> GH06388.complete
CAAAATAAGGTCTTGGCGCAAAGTGTGCCTAGAGGAGCACAGGAGAGTTT
ACATACCTTAAAAGGTTATACCACAAGGACTAGATCAATGCAGCGATCAC
TGTTACTACTGGCCGTGTCAGCCATCCTTTTCTGTGCTGCAGTGGCTCTG
CCCTCAAGACTAACCAAATCCGAGGAGGATTGGCTGGAGCAGATGCTGAC
GCTGAGCGAAGACAGCGGTGAACTGCAGGACCTGGACGAGAGCACCGGAA
TCCATATTATCAAACGATCTGCCAAGGATGCCAGCAGCTCATCTGAGGAG
CATAATGACAAAGCCAAAGACAAGGCCAAGAACAAGGCGGACAGCTCCGG
CGATTCCTCCTCCGAGGAAAAGACAACACCAGCTGCGGTAGAAGAAACAA
CTACGGAGCACACTGCTAGGAAACGCAGAAGCACGGAGGATACGATGGTG
CGATCCTTTTGCCAGTCACTGAAAGAATTCGATATTAAGAATTTCAATCT
ACAATCTGCATATGACCGGGCCGTAAGCTTTTGTAAGCAAAGGGAGTCTA
GACGAAGACGCCAGGCTGCCGATCAGAAATCCAGCGATGCGCCGGACCTG
GATGCCCAGGCTGAGAAGGAACTGGACGAGCAGATGGCGCAGGCTGTGGC
GGAGCTTTTGAAGGACAAGGACAACACCAGCATCGAAGACTACGCCCAGG
GATGCGAGGTCATGGAGGTTAGCTCCAAAGAGGCCAACGAGGCCACCTAT
GCCGAATGATTTTGAATAAACATAAATAACATTAAAAAAAAAAAAAAAAA
AAA

GH06388.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4716-RA 864 CG4716-RA 14..797 1..784 3920 100 Plus
CG4716.a 884 CG4716.a 97..543 1..447 2235 100 Plus
CG4716-RB 720 CG4716-RB 97..543 1..447 2235 100 Plus
CG4716.a 884 CG4716.a 543..800 527..784 1290 100 Plus
CG4716-RB 720 CG4716-RB 543..720 527..704 890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9143957..9144739 1..783 3885 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13256596..13257379 1..784 3920 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13257795..13258578 1..784 3920 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:03:36 has no hits.

GH06388.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:04:30 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9143957..9144739 1..783 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:20:40 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 1..672 88..759 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:49:53 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 1..672 88..759 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:51 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 1..672 88..759 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:41:09 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 1..672 88..759 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:57:10 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 1..672 88..759 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:02:42 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 14..796 1..783 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:49:53 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 14..796 1..783 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:51 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 14..796 1..783 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:41:09 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 14..796 1..783 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:57:10 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
CG4716-RA 10..792 1..783 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:30 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13256596..13257378 1..783 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:30 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13256596..13257378 1..783 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:04:30 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13256596..13257378 1..783 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:51 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9144101..9144883 1..783 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:11:39 Download gff for GH06388.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13257795..13258577 1..783 100   Plus

GH06388.hyp Sequence

Translation from 1 to 758

> GH06388.hyp
QNKVLAQSVPRGAQESLHTLKGYTTRTRSMQRSLLLLAVSAILFCAAVAL
PSRLTKSEEDWLEQMLTLSEDSGELQDLDESTGIHIIKRSAKDASSSSEE
HNDKAKDKAKNKADSSGDSSSEEKTTPAAVEETTTEHTARKRRSTEDTMV
RSFCQSLKEFDIKNFNLQSAYDRAVSFCKQRESRRRRQAADQKSSDAPDL
DAQAEKELDEQMAQAVAELLKDKDNTSIEDYAQGCEVMEVSSKEANEATY
AE*

GH06388.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG4716-PC 223 CG4716-PC 1..223 30..252 1106 100 Plus
CG4716-PA 223 CG4716-PA 1..223 30..252 1106 100 Plus
CG4716-PB 122 CG4716-PB 1..121 30..150 590 99.2 Plus

GH06388.pep Sequence

Translation from 87 to 758

> GH06388.pep
MQRSLLLLAVSAILFCAAVALPSRLTKSEEDWLEQMLTLSEDSGELQDLD
ESTGIHIIKRSAKDASSSSEEHNDKAKDKAKNKADSSGDSSSEEKTTPAA
VEETTTEHTARKRRSTEDTMVRSFCQSLKEFDIKNFNLQSAYDRAVSFCK
QRESRRRRQAADQKSSDAPDLDAQAEKELDEQMAQAVAELLKDKDNTSIE
DYAQGCEVMEVSSKEANEATYAE*

GH06388.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13685-PA 207 GF13685-PA 1..206 1..221 208 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20372-PA 210 GG20372-PA 1..210 1..223 673 69.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG4716-PC 223 CG4716-PC 1..223 1..223 1106 100 Plus
CG4716-PA 223 CG4716-PA 1..223 1..223 1106 100 Plus
CG4716-PB 122 CG4716-PB 1..121 1..121 590 99.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11003-PA 253 GL11003-PA 62..253 48..223 206 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24565-PA 253 GA24565-PA 139..253 62..223 183 41.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21459-PA 218 GM21459-PA 1..218 1..223 833 80.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10957-PA 223 GD10957-PA 1..223 1..223 862 82.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17979-PA 313 GK17979-PA 233..313 155..223 160 51.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12531-PA 220 GE12531-PA 1..220 1..223 719 70.1 Plus