Clone GH06474 Report

Search the DGRC for GH06474

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:64
Well:74
Vector:pOT2
Associated Gene/TranscriptCG4377-RA
Protein status:GH06474.pep: gold
Preliminary Size:930
Sequenced Size:795

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4377 2001-01-01 Release 2 assignment
CG4377 2003-01-01 Sim4 clustering to Release 3
CG4377 2003-03-19 Blastp of sequenced clone
CG4377 2008-04-29 Release 5.5 accounting
CG4377 2008-08-15 Release 5.9 accounting
CG4377 2008-12-18 5.12 accounting

Clone Sequence Records

GH06474.complete Sequence

795 bp (795 high quality bases) assembled on 2003-03-19

GenBank Submission: AY060639

> GH06474.complete
TTGGAAGCTCTTCAAAAATGTTGCAATCGGGCAAATTTGTTATACTACTG
GCTTTATTCCTGGCTTCACGGGAAATCTCAGGAGAAATTTCTAGGGAGGT
GCGCAATTCAGCTGAATCGCCAAAATGTTACAGCTGTGAAGGCATAAATT
GTTCGAGAACCACTCGTCAAAACGCCACCGTTAGCTGTTCTGATAGACTG
GACGTTTGCGTCACCATTTATGAGGATTTTGCTGTTAGTGAGCGCGGTTG
CTTTTCTCAAATCTCTTTGGCTGGTCAAGCGAAATGTGCGGCCAAGGACG
ATCAATGTCAAAAGTGCAGTGGACAGCTGTGCAATAATGTAGGACGCAGG
GATTTCAAATGCATTCAATGCATTGGTTCTGATTCAGCTGATTGCAACAA
GGGTGCCACCGCCTCCTTGGCCGCCACCCAATGTGCCCTCCCCACCTCCG
CCAATTCCTACTGTTATGTCAAGGTAGTCGGCGATCAGAAGGACAGCCTC
CAGAGAGGATGTGCTCTTTCTGTTAAGGAGCAGAAGGCCTGCTTGGAGGA
CTCGAAATGCTCGCTCTGCCTGCCGGAAAACTCCAGCGACTCCGTGGCCT
GCAACAACTACGATTTGGAATTGGGACCCAAGTCCTCAGCTGAGCAAAGT
AAAAAACTCTTGAGCTACGGGTTGGCTTTCTTTGCCCTGCTCTCGCTTAA
ATTGCTGAATTAAATTTTAAATAAATATATGTAAATAAAGCGAATAATCA
CTTGCTTACTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH06474.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4377-RA 815 CG4377-RA 51..813 1..763 3815 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17721854..17722231 761..384 1890 100 Minus
chr2R 21145070 chr2R 17722509..17722736 228..1 1140 100 Minus
chr2R 21145070 chr2R 17722296..17722450 383..229 775 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21835446..21835825 763..384 1900 100 Minus
2R 25286936 2R 21836103..21836330 228..1 1140 100 Minus
2R 25286936 2R 21835890..21836044 383..229 775 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21836645..21837024 763..384 1900 100 Minus
2R 25260384 2R 21837302..21837529 228..1 1140 100 Minus
2R 25260384 2R 21837089..21837243 383..229 775 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:52:13 has no hits.

GH06474.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:52:50 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17721854..17722231 384..761 91 <- Minus
chr2R 17722296..17722450 229..383 100 <- Minus
chr2R 17722509..17722736 1..228 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:20:51 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..696 18..713 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:17 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..696 18..713 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:03 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..696 18..713 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:44 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..696 18..713 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:59 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..696 18..713 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:40 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..761 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:17 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..761 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:03 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 28..788 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:44 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 1..761 1..761 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:59 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
CG4377-RA 28..788 1..761 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:50 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21835890..21836044 229..383 100 <- Minus
2R 21836103..21836330 1..228 100   Minus
2R 21835448..21835825 384..761 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:50 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21835890..21836044 229..383 100 <- Minus
2R 21836103..21836330 1..228 100   Minus
2R 21835448..21835825 384..761 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:50 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21835890..21836044 229..383 100 <- Minus
2R 21836103..21836330 1..228 100   Minus
2R 21835448..21835825 384..761 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:03 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17722953..17723330 384..761 100 <- Minus
arm_2R 17723395..17723549 229..383 100 <- Minus
arm_2R 17723608..17723835 1..228 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:55 Download gff for GH06474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21837302..21837529 1..228 100   Minus
2R 21836647..21837024 384..761 100 <- Minus
2R 21837089..21837243 229..383 100 <- Minus

GH06474.hyp Sequence

Translation from 2 to 712

> GH06474.hyp
GSSSKMLQSGKFVILLALFLASREISGEISREVRNSAESPKCYSCEGINC
SRTTRQNATVSCSDRLDVCVTIYEDFAVSERGCFSQISLAGQAKCAAKDD
QCQKCSGQLCNNVGRRDFKCIQCIGSDSADCNKGATASLAATQCALPTSA
NSYCYVKVVGDQKDSLQRGCALSVKEQKACLEDSKCSLCLPENSSDSVAC
NNYDLELGPKSSAEQSKKLLSYGLAFFALLSLKLLN*

GH06474.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG4377-PA 231 CG4377-PA 1..231 6..236 1201 100 Plus
CG4363-PA 199 CG4363-PA 30..183 42..201 322 41.2 Plus
CG34040-PA 281 CG34040-PA 23..174 39..191 286 36.3 Plus

GH06474.pep Sequence

Translation from 17 to 712

> GH06474.pep
MLQSGKFVILLALFLASREISGEISREVRNSAESPKCYSCEGINCSRTTR
QNATVSCSDRLDVCVTIYEDFAVSERGCFSQISLAGQAKCAAKDDQCQKC
SGQLCNNVGRRDFKCIQCIGSDSADCNKGATASLAATQCALPTSANSYCY
VKVVGDQKDSLQRGCALSVKEQKACLEDSKCSLCLPENSSDSVACNNYDL
ELGPKSSAEQSKKLLSYGLAFFALLSLKLLN*

GH06474.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11610-PA 225 GF11610-PA 1..225 1..231 796 66.7 Plus
Dana\GF11611-PA 199 GF11611-PA 30..185 37..201 297 43 Plus
Dana\GF11614-PA 231 GF11614-PA 24..219 34..231 224 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20739-PA 231 GG20739-PA 1..231 1..231 1100 91.8 Plus
Dere\GG20740-PA 199 GG20740-PA 30..173 37..186 273 42 Plus
Dere\GG20741-PA 309 GG20741-PA 23..174 34..186 236 35.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20772-PA 222 GH20772-PA 3..204 2..213 556 55.4 Plus
Dgri\GH20773-PA 203 GH20773-PA 28..188 37..200 289 40.6 Plus
Dgri\GH20774-PA 273 GH20774-PA 24..186 34..201 227 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4377-PA 231 CG4377-PA 1..231 1..231 1201 100 Plus
CG4363-PA 199 CG4363-PA 30..183 37..196 322 41.2 Plus
CG34040-PA 281 CG34040-PA 23..174 34..186 286 36.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20855-PA 221 GI20855-PA 1..206 1..215 562 54 Plus
Dmoj\GI20856-PA 201 GI20856-PA 28..188 37..202 305 43.7 Plus
Dmoj\GI20858-PA 271 GI20858-PA 24..186 34..201 240 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17510-PA 228 GL17510-PA 4..211 2..214 688 63.8 Plus
Dper\GL17511-PA 196 GL17511-PA 27..170 37..186 243 40 Plus
Dper\GL17512-PA 237 GL17512-PA 27..176 36..188 213 33.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18144-PA 228 GA18144-PA 4..211 2..214 692 64.3 Plus
Dpse\GA18134-PA 196 GA18134-PA 27..170 37..186 244 40 Plus
Dpse\GA24185-PA 285 GA24185-PA 27..174 36..186 214 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15682-PA 231 GM15682-PA 1..231 1..231 1140 94.8 Plus
Dsec\GM15683-PA 199 GM15683-PA 30..173 37..186 254 41.3 Plus
Dsec\GM15684-PA 289 GM15684-PA 23..174 34..186 231 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25161-PA 231 GD25161-PA 1..231 1..231 1147 95.2 Plus
Dsim\GD25162-PA 199 GD25162-PA 30..173 37..186 257 42.7 Plus
Dsim\GD25163-PA 281 GD25163-PA 23..174 34..186 240 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20590-PA 222 GJ20590-PA 1..195 1..202 549 56.7 Plus
Dvir\GJ20591-PA 201 GJ20591-PA 28..186 37..200 269 39.4 Plus
Dvir\GJ20593-PA 279 GJ20593-PA 11..186 9..201 255 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15645-PA 209 GK15645-PA 17..195 32..216 552 59.1 Plus
Dwil\GK15646-PA 197 GK15646-PA 28..183 37..201 300 43 Plus
Dwil\GK19090-PA 255 GK19090-PA 25..179 36..201 234 35.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13671-PA 231 GE13671-PA 1..217 1..217 990 87.6 Plus
Dyak\GE13673-PA 310 GE13673-PA 9..174 9..186 236 34.1 Plus
Dyak\GE13672-PA 199 GE13672-PA 30..173 37..186 235 43.4 Plus