Clone GH06489 Report

Search the DGRC for GH06489

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:64
Well:89
Vector:pOT2
Associated Gene/TranscriptMst87F-RA
Protein status:GH06489.pep: gold
Preliminary Size:356
Sequenced Size:471

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17956 2002-01-01 Sim4 clustering to Release 2
Mst87F 2008-04-29 Stopped prior to 5.5
Mst87F 2008-12-18 5.12 accounting

Clone Sequence Records

GH06489.complete Sequence

471 bp assembled on 2008-10-15

GenBank Submission: BT050522.1

> GH06489.complete
TATACCTGTGCGTAACCAGATTTTGTATCATTATTATTTGTCCTTTCGGC
CTGAACACATCAAAATTTGTCGTCTAGTCTCAAATTATTTCTTTTTGTTC
GGTTCAAAAACTTTTACGAATTAATCATGTGCTGCGGACCCTGTGGACCC
TGCTGCGGACCTTGCTGCGGACCCTGCTGTGGTCCATGCGGACCATGCGG
AGGAGGATGTGGACCCTGCTATGGACCGAATGTCTGCGGACCATGCTATG
CCTGTGGACCCTGTGGCGGCTGCTATTGTGGATACCCTTGCTGCTAGACA
GTTGCAACTGGCCATGTCCAAGAAGGGTTCACCAGAACACCAAGACGATA
GGATAGAACCTATCCCTATTTCATCCTCGTATTCATCTAATATTCGTGAA
CCACAAATATAGGTATTTGAGACAATAAATATGAGGTGTAAGCTTCAAAA
AAAAAAAAAAAAAAACCGGCA

GH06489.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Mst87F.a 708 Mst87F.a 33..480 1..448 2240 100 Plus
Mst87F-RA 753 Mst87F-RA 78..525 1..448 2240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9652082..9652421 448..109 1685 99.7 Minus
chr3R 27901430 chr3R 9652512..9652619 108..1 495 97.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:34:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13827149..13827488 448..109 1700 100 Minus
3R 32079331 3R 13827579..13827686 108..1 540 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13567980..13568319 448..109 1700 100 Minus
3R 31820162 3R 13568410..13568517 108..1 540 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:15:07 has no hits.

GH06489.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:16:06 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9652084..9652421 109..446 99 <- Minus
chr3R 9652512..9652619 1..108 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:20:55 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 1..171 127..297 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:26 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 1..171 127..297 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:05:31 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 1..171 127..297 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:04:45 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 1..171 127..297 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:54:28 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 25..470 1..446 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:26 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 25..470 1..446 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:05:31 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 25..470 1..446 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-17 12:05:31 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 25..470 1..446 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:04:45 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
Mst87F-RA 1..446 1..446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:06 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13827151..13827488 109..446 100 <- Minus
3R 13827579..13827686 1..108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:06 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13827151..13827488 109..446 100 <- Minus
3R 13827579..13827686 1..108 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:06 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13827151..13827488 109..446 100 <- Minus
3R 13827579..13827686 1..108 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:05:31 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9652873..9653210 109..446 100 <- Minus
arm_3R 9653301..9653408 1..108 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:17 Download gff for GH06489.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13567982..13568319 109..446 100 <- Minus
3R 13568410..13568517 1..108 100   Minus

GH06489.pep Sequence

Translation from 126 to 296

> GH06489.pep
MCCGPCGPCCGPCCGPCCGPCGPCGGGCGPCYGPNVCGPCYACGPCGGCY
CGYPCC*

GH06489.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17020-PA 56 GG17020-PA 1..56 1..56 209 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Mst87F-PB 56 CG17956-PB 1..56 1..56 409 100 Plus
Mst87F-PA 56 CG17956-PA 1..56 1..56 409 100 Plus
Mst84Dd-PA 72 CG17935-PA 9..58 2..52 257 79.2 Plus
Mst84Dc-PB 55 CG17945-PB 1..55 1..51 225 68.4 Plus
Mst84Dc-PA 55 CG17945-PA 1..55 1..51 225 68.4 Plus
Mst98Cb-PA 265 CG18396-PA 204..262 3..55 207 62.9 Plus
Mst84Db-PA 74 CG17934-PA 1..65 1..56 202 55.9 Plus
Mst84Db-PA 74 CG17934-PA 19..73 3..52 201 65.5 Plus
Mst84Da-PA 63 CG17946-PA 14..63 7..56 198 64.9 Plus
Pif2-PA 118 CG31483-PA 1..58 1..56 191 54.8 Plus
Mst98Ca-PA 334 CG11719-PA 207..284 3..55 184 51.9 Plus
Pif2-PA 118 CG31483-PA 72..117 2..51 169 58.8 Plus
Mst98Cb-PA 265 CG18396-PA 172..243 3..56 168 52 Plus
Pif2-PA 118 CG31483-PA 37..105 2..56 168 47.9 Plus
Mst84Da-PA 63 CG17946-PA 16..62 2..46 165 58.2 Plus
Mst98Ca-PA 334 CG11719-PA 264..328 3..55 161 49.2 Plus
Mst98Ca-PA 334 CG11719-PA 180..250 3..55 153 51.4 Plus
CG31740-PA 61 CG31740-PA 5..61 1..53 152 49.2 Plus
Mst84Dd-PA 72 CG17935-PA 32..71 2..39 147 63.4 Plus
Mst84Dd-PA 72 CG17935-PA 3..43 10..55 146 64.6 Plus
CG9130-PB 517 CG9130-PB 240..298 2..54 146 52.5 Plus
CG9130-PA 517 CG9130-PA 240..298 2..54 146 52.5 Plus
CG9130-PB 517 CG9130-PB 230..289 3..56 143 46.9 Plus
CG9130-PA 517 CG9130-PA 230..289 3..56 143 46.9 Plus
Mst98Ca-PA 334 CG11719-PA 157..242 2..55 142 43.2 Plus
CG30430-PB 51 CG30430-PB 3..44 6..56 140 52.9 Plus
CG30430-PA 51 CG30430-PA 3..44 6..56 140 52.9 Plus
CG30430-PB 51 CG30430-PB 1..49 1..45 131 53.8 Plus
CG30430-PA 51 CG30430-PA 1..49 1..45 131 53.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25906-PA 56 GM25906-PA 1..56 1..56 204 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20474-PA 56 GD20474-PA 1..56 1..56 209 100 Plus

GH06489.hyp Sequence

Translation from 220 to 411

> GH06489.hyp
MDRMSADHAMPVDPVAAAIVDTLAARQLQLAMSKKGSPEHQDDRIEPIPI
SSSYSSNIREPQI*
Sequence GH06489.hyp has no blast hits.