Clone GH07085 Report

Search the DGRC for GH07085

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:70
Well:85
Vector:pOT2
Associated Gene/TranscriptCG6746-RA
Protein status:GH07085.pep: gold
Preliminary Size:1300
Sequenced Size:1044

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6746 2001-01-01 Release 2 assignment
CG6746 2003-01-01 Sim4 clustering to Release 3
CG6746 2003-04-01 Blastp of sequenced clone
CG6746 2008-04-29 Release 5.5 accounting
CG6746 2008-08-15 Release 5.9 accounting
CG6746 2008-12-18 5.12 accounting

Clone Sequence Records

GH07085.complete Sequence

1044 bp (1044 high quality bases) assembled on 2003-04-01

GenBank Submission: AY069058

> GH07085.complete
TGAAAGCGACTTCGGAATTATCGCGCTACAGGGCGATAAGACTGTGACGA
CTGATTAGTTAACCAGCGGCGATCGGCAAGGTGAAAGTTCACACATCTCC
GCTCCAACATGTCAGCAAAGGCAGTGTCCAAGTCCAGCAAACCAGGCGCT
TCCAAGGAGCCGTCGGCGGTCACTAAATTGTACCTGTTTGCGTACAACGC
CGGCCAGGTGGTCGGATGGAGCTACATCCTGTGGCAGCTGGTCAACTACT
ACATATTGCAGGGTCCGGAGTTCCGTGCCCAGGTGACGTTGTGGGAGTAT
ACTCGGCTGGCCGTGATCATCTTCCAGAATGCCGCGTTCGTGGAGATACT
CAATGCTTCTTTTGGATTGGTCAAGTCGAACCCGGTGGTCACTGGCTTCC
AGGTGTTCAGCCGCATGATGGTGGTCGTCGGCGTGGTGATGGCCACGCCT
ACTGGAAAGGTTTCACCCGGTCTGCCCATCGCCCTGCTGGCCTGGGCCAT
CACTGAGATCATCCGATATGGATATTACGCTCTGAACATCGTCAAGGTGG
TGCCGCATTTTGTGGTGTTCCTGCGCTACACCACATTCATTGTCCTGTAT
CCCATCGGCGTGACTGGGGAGCTGCTGTGCTTCTGGTGGGCCCAGAGCTA
TGCCCGTGAGAACAGCGTGTGGAGTGTGGTGATGCCCAACAAGTGGAACG
CCACCTTCTCGTATTTTGGATTCCTGTGGATCGTCATGCTCGGCTACATC
CCCATCTTCCCGCAGTTGTACTTGCACATGTTCGCCCAGCGCCGTAAGAT
CCTGGGCGGTGGATCCAGCGGCTCACCCCAGAAGAAGGCCAACTGAACCT
TGACCAGCGGCGAATGCAAATTATTGCATCATTTGCATATCATTGGCCGT
CGCACTTTGAGCCGTTTTCGCTTTTTGGGGTCTCTCTTGCCTCACCTCTT
ACACAAGCACATTCGTTCGGACTAAGCTTAGTTATAAGTGGTTTTGTGTA
CAAATAAACCTAGATACTCTTCCAACAAAAAAAAAAAAAAAAAA

GH07085.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG6746-RA 1043 CG6746-RA 18..1043 1..1026 5130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11999896..12000921 1026..1 5130 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:35:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12001231..12002259 1029..1 5145 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12001231..12002259 1029..1 5145 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:01:15 has no hits.

GH07085.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:02:32 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11999896..12000921 1..1026 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:22:07 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 1..738 109..846 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:39 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 1..738 109..846 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:21 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 1..738 109..846 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:58 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 1..738 109..846 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:06 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 18..1043 1..1026 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:39 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 18..1043 1..1026 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:21 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 8..1033 1..1026 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:30 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 18..1043 1..1026 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:58 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
CG6746-RA 8..1033 1..1026 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:32 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12001234..12002259 1..1026 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:32 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12001234..12002259 1..1026 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:32 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12001234..12002259 1..1026 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:21 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12001234..12002259 1..1026 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:25 Download gff for GH07085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12001234..12002259 1..1026 100   Minus

GH07085.hyp Sequence

Translation from 108 to 845

> GH07085.hyp
MSAKAVSKSSKPGASKEPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYIL
QGPEFRAQVTLWEYTRLAVIIFQNAAFVEILNASFGLVKSNPVVTGFQVF
SRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYYALNIVKVVPH
FVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATF
SYFGFLWIVMLGYIPIFPQLYLHMFAQRRKILGGGSSGSPQKKAN*

GH07085.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG6746-PA 245 CG6746-PA 1..245 1..245 1283 100 Plus
CG9267-PA 371 CG9267-PA 149..366 23..241 241 29.7 Plus

GH07085.pep Sequence

Translation from 108 to 845

> GH07085.pep
MSAKAVSKSSKPGASKEPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYIL
QGPEFRAQVTLWEYTRLAVIIFQNAAFVEILNASFGLVKSNPVVTGFQVF
SRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYYALNIVKVVPH
FVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATF
SYFGFLWIVMLGYIPIFPQLYLHMFAQRRKILGGGSSGSPQKKAN*

GH07085.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15500-PA 243 GF15500-PA 1..243 1..245 1130 92.7 Plus
Dana\GF21639-PA 371 GF21639-PA 145..366 19..241 191 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10286-PA 244 GG10286-PA 1..244 1..245 1223 96.7 Plus
Dere\GG10197-PA 371 GG10197-PA 145..366 19..241 219 29.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13780-PA 240 GH13780-PA 1..240 1..245 994 81.6 Plus
Dgri\GH11094-PA 387 GH11094-PA 169..384 23..239 255 31.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Hacd1-PA 245 CG6746-PA 1..245 1..245 1283 100 Plus
Hacd2-PA 371 CG9267-PA 149..366 23..241 241 29.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17184-PA 240 GI17184-PA 1..240 1..245 992 82.4 Plus
Dmoj\GI18216-PA 378 GI18216-PA 160..336 23..201 227 31.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14177-PA 248 GL14177-PA 1..245 1..243 1054 88.3 Plus
Dper\GL25700-PA 370 GL25700-PA 145..370 19..245 193 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19829-PA 248 GA19829-PA 1..245 1..243 1054 88.3 Plus
Dpse\GA21658-PA 370 GA21658-PA 145..370 19..245 193 27.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26451-PA 245 GM26451-PA 1..245 1..245 1265 99.6 Plus
Dsec\GM25510-PA 371 GM25510-PA 133..366 5..241 220 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22144-PA 245 GD22144-PA 1..245 1..245 1260 99.2 Plus
Dsim\GD22057-PA 371 GD22057-PA 145..366 19..241 218 29.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22182-PA 240 GJ22182-PA 1..240 1..245 993 83.3 Plus
Dvir\GJ18122-PA 378 GJ18122-PA 160..373 23..237 254 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23928-PA 249 GK23928-PA 1..234 1..234 1017 87.2 Plus
Dwil\GK15278-PA 400 GK15278-PA 175..400 19..245 208 28.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12555-PA 244 GE12555-PA 1..244 1..245 1226 96.7 Plus
Dyak\GE11580-PA 371 GE11580-PA 145..366 19..241 213 29.2 Plus