Clone GH07145 Report

Search the DGRC for GH07145

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:71
Well:45
Vector:pOT2
Associated Gene/TranscriptGXIVsPLA2-RC
Protein status:GH07145.pep: gold
Preliminary Size:1111
Sequenced Size:961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17035 2001-01-01 Release 2 assignment
CG17035 2002-03-19 Blastp of sequenced clone
CG17035 2003-01-01 Sim4 clustering to Release 3
GXIVsPLA2 2008-04-29 Release 5.5 accounting
GXIVsPLA2 2008-08-15 Release 5.9 accounting
GXIVsPLA2 2008-12-18 5.12 accounting

Clone Sequence Records

GH07145.complete Sequence

961 bp (961 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094681.1

> GH07145.complete
AAACAACAAATAGCTGACCCTTCAAAAACGAATTAAACAGCGAACATGCA
GTTCTCTTGGATGAAGGTGGCCATATACCTTCTTACGTTCCTAACCTACG
CCTATTCAGGCTATGGATCCAGCACCATAGTCCACGTAAGCTAAGGGATG
CCATTATAGCCGCGGAGGCGATCTTTGGTGACGTGTTCAAGAACCTGATA
GTGCTGGTGCGCAAATTTCGCACGGTCCACGAGGTTTTCGATGCGGCCGT
GGACGAGAACTGCATATACCAGTGCCCCGCACCGGATATCGGAGGACCAG
CGCCCAGAGCGGTTCAGAATAAGTTCTATACCCCCACCGCAGATGGATGT
GGTTCCTTGGGCCTGAGGATCAGCACAGACTATCTGCCGGCCAAGGAGAT
GGAGACATGTTGCAATGACCACGATATCTGCTACGACACCTGCAATAGCG
ATAAGGAGCTGTGCGACCTGGACTTCAAGAGGTGCTTGTACAAGTACTGC
GACAGCTACGAGAAGTCCATAGCCAGCGATCTGATGATGAAGGGCTGCAA
GGCGGCTGCCAAGATGCTATTCACCGGCACATTGACCCTGGGATGCCGCT
CCTATCTGGACTCCCAGCAGAGATCCTGCTATTGCGCCCCGCCGAAGAGC
TCCTCCTACAATGGCAATAGGCAGGGTAATAGCAATAGTAGGGAGAAGCA
GCAGCGCCAGAAATATGGCTGGAAGGATCGCAACGAGATATAGTACAGGA
TCACTGGCTACGAGGGTGCGGGGACCTGGGGGTATCGGATTAAGCGTTAA
ATGTTTTATGTGTTGTGTTAGTCTATGAATTGGGTAGCCATGTCCATTGG
ACTCCCTTTTTGACGAATTTCATTATTGTATACCAAATAGTGGCATGCCA
ACGGTCCAGACTGTTAAATACATTGATATTTTTACCTATTATAAAAAAAA
AAAAAAAAAAA

GH07145.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
GXIVsPLA2-RC 1216 GXIVsPLA2-RC 62..1006 1..945 4725 100 Plus
GXIVsPLA2-RA 1259 GXIVsPLA2-RA 110..1049 1..945 4625 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15945430..15946074 298..942 3210 99.8 Plus
chr3L 24539361 chr3L 15945208..15945369 139..300 810 100 Plus
chr3L 24539361 chr3L 15944997..15945136 1..140 700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:35:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15955608..15956255 298..945 3240 100 Plus
3L 28110227 3L 15955386..15955547 139..300 810 100 Plus
3L 28110227 3L 15955175..15955314 1..140 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15948708..15949355 298..945 3240 100 Plus
3L 28103327 3L 15948486..15948647 139..300 810 100 Plus
3L 28103327 3L 15948275..15948414 1..140 700 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:12:55 has no hits.

GH07145.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:14:03 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15944997..15945136 1..140 100 -> Plus
chr3L 15945210..15945369 141..300 100 -> Plus
chr3L 15945433..15946074 301..942 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:22:18 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RA 1..693 46..743 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:30 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RA 1..693 46..743 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:40:10 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RA 1..693 46..743 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:45 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RA 1..693 46..743 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:46:02 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RA 1..693 46..743 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:53 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 1..942 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:30 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 1..942 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:40:10 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 80..1021 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:45 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 1..942 1..942 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:46:02 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 80..1021 1..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:03 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15955175..15955314 1..140 100 -> Plus
3L 15955388..15955547 141..300 100 -> Plus
3L 15955611..15956252 301..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:03 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15955175..15955314 1..140 100 -> Plus
3L 15955388..15955547 141..300 100 -> Plus
3L 15955611..15956252 301..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:03 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15955175..15955314 1..140 100 -> Plus
3L 15955388..15955547 141..300 100 -> Plus
3L 15955611..15956252 301..942 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:40:10 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15948275..15948414 1..140 100 -> Plus
arm_3L 15948488..15948647 141..300 100 -> Plus
arm_3L 15948711..15949352 301..942 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:29 Download gff for GH07145.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15948711..15949352 301..942 100   Plus
3L 15948275..15948414 1..140 100 -> Plus
3L 15948488..15948647 141..300 100 -> Plus

GH07145.pep Sequence

Translation from 45 to 143

> GH07145.pep
MQFSWMKVAIYLLTFLTYAYSGYGSSTIVHVS*

GH07145.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24097-PA 226 GF24097-PA 1..31 1..31 165 96.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15933-PA 230 GG15933-PA 1..31 1..31 167 96.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14770-PA 230 GH14770-PA 1..31 1..31 160 93.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
GXIVsPLA2-PC 32 CG17035-PC 1..32 1..32 166 100 Plus
GXIVsPLA2-PD 230 CG17035-PD 1..31 1..31 159 96.8 Plus
GXIVsPLA2-PA 230 CG17035-PA 1..31 1..31 159 96.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11872-PA 228 GI11872-PA 1..31 1..31 161 93.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25215-PA 228 GL25215-PA 1..31 1..31 161 96.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14287-PA 228 GA14287-PA 1..31 1..31 161 96.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25562-PA 230 GM25562-PA 1..31 1..31 167 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14577-PA 230 GD14577-PA 1..31 1..31 167 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13568-PA 228 GJ13568-PA 1..31 1..31 164 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16013-PA 232 GK16013-PA 1..31 1..31 160 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22866-PA 230 GE22866-PA 1..31 1..31 167 96.8 Plus
Dyak\GE22283-PA 315 GE22283-PA 1..30 1..30 166 100 Plus

GH07145.hyp Sequence

Translation from 398 to 742

> GH07145.hyp
METCCNDHDICYDTCNSDKELCDLDFKRCLYKYCDSYEKSIASDLMMKGC
KAAAKMLFTGTLTLGCRSYLDSQQRSCYCAPPKSSSYNGNRQGNSNSREK
QQRQKYGWKDRNEI*

GH07145.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
GXIVsPLA2-PD 230 CG17035-PD 117..230 1..114 640 100 Plus
GXIVsPLA2-PA 230 CG17035-PA 117..230 1..114 640 100 Plus