BDGP Sequence Production Resources |
Search the DGRC for GH07145
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 71 |
Well: | 45 |
Vector: | pOT2 |
Associated Gene/Transcript | GXIVsPLA2-RC |
Protein status: | GH07145.pep: gold |
Preliminary Size: | 1111 |
Sequenced Size: | 961 |
Gene | Date | Evidence |
---|---|---|
CG17035 | 2001-01-01 | Release 2 assignment |
CG17035 | 2002-03-19 | Blastp of sequenced clone |
CG17035 | 2003-01-01 | Sim4 clustering to Release 3 |
GXIVsPLA2 | 2008-04-29 | Release 5.5 accounting |
GXIVsPLA2 | 2008-08-15 | Release 5.9 accounting |
GXIVsPLA2 | 2008-12-18 | 5.12 accounting |
961 bp (961 high quality bases) assembled on 2002-03-19
GenBank Submission: AY094681.1
> GH07145.complete AAACAACAAATAGCTGACCCTTCAAAAACGAATTAAACAGCGAACATGCA GTTCTCTTGGATGAAGGTGGCCATATACCTTCTTACGTTCCTAACCTACG CCTATTCAGGCTATGGATCCAGCACCATAGTCCACGTAAGCTAAGGGATG CCATTATAGCCGCGGAGGCGATCTTTGGTGACGTGTTCAAGAACCTGATA GTGCTGGTGCGCAAATTTCGCACGGTCCACGAGGTTTTCGATGCGGCCGT GGACGAGAACTGCATATACCAGTGCCCCGCACCGGATATCGGAGGACCAG CGCCCAGAGCGGTTCAGAATAAGTTCTATACCCCCACCGCAGATGGATGT GGTTCCTTGGGCCTGAGGATCAGCACAGACTATCTGCCGGCCAAGGAGAT GGAGACATGTTGCAATGACCACGATATCTGCTACGACACCTGCAATAGCG ATAAGGAGCTGTGCGACCTGGACTTCAAGAGGTGCTTGTACAAGTACTGC GACAGCTACGAGAAGTCCATAGCCAGCGATCTGATGATGAAGGGCTGCAA GGCGGCTGCCAAGATGCTATTCACCGGCACATTGACCCTGGGATGCCGCT CCTATCTGGACTCCCAGCAGAGATCCTGCTATTGCGCCCCGCCGAAGAGC TCCTCCTACAATGGCAATAGGCAGGGTAATAGCAATAGTAGGGAGAAGCA GCAGCGCCAGAAATATGGCTGGAAGGATCGCAACGAGATATAGTACAGGA TCACTGGCTACGAGGGTGCGGGGACCTGGGGGTATCGGATTAAGCGTTAA ATGTTTTATGTGTTGTGTTAGTCTATGAATTGGGTAGCCATGTCCATTGG ACTCCCTTTTTGACGAATTTCATTATTGTATACCAAATAGTGGCATGCCA ACGGTCCAGACTGTTAAATACATTGATATTTTTACCTATTATAAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15945430..15946074 | 298..942 | 3210 | 99.8 | Plus |
chr3L | 24539361 | chr3L | 15945208..15945369 | 139..300 | 810 | 100 | Plus |
chr3L | 24539361 | chr3L | 15944997..15945136 | 1..140 | 700 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 15955608..15956255 | 298..945 | 3240 | 100 | Plus |
3L | 28110227 | 3L | 15955386..15955547 | 139..300 | 810 | 100 | Plus |
3L | 28110227 | 3L | 15955175..15955314 | 1..140 | 700 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15948708..15949355 | 298..945 | 3240 | 100 | Plus |
3L | 28103327 | 3L | 15948486..15948647 | 139..300 | 810 | 100 | Plus |
3L | 28103327 | 3L | 15948275..15948414 | 1..140 | 700 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15944997..15945136 | 1..140 | 100 | -> | Plus |
chr3L | 15945210..15945369 | 141..300 | 100 | -> | Plus |
chr3L | 15945433..15946074 | 301..942 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RA | 1..693 | 46..743 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RA | 1..693 | 46..743 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RA | 1..693 | 46..743 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RA | 1..693 | 46..743 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RA | 1..693 | 46..743 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RC | 1..942 | 1..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RC | 1..942 | 1..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RC | 80..1021 | 1..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RC | 1..942 | 1..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GXIVsPLA2-RC | 80..1021 | 1..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15955175..15955314 | 1..140 | 100 | -> | Plus |
3L | 15955388..15955547 | 141..300 | 100 | -> | Plus |
3L | 15955611..15956252 | 301..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15955175..15955314 | 1..140 | 100 | -> | Plus |
3L | 15955388..15955547 | 141..300 | 100 | -> | Plus |
3L | 15955611..15956252 | 301..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15955175..15955314 | 1..140 | 100 | -> | Plus |
3L | 15955388..15955547 | 141..300 | 100 | -> | Plus |
3L | 15955611..15956252 | 301..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15948275..15948414 | 1..140 | 100 | -> | Plus |
arm_3L | 15948488..15948647 | 141..300 | 100 | -> | Plus |
arm_3L | 15948711..15949352 | 301..942 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15948711..15949352 | 301..942 | 100 | Plus | |
3L | 15948275..15948414 | 1..140 | 100 | -> | Plus |
3L | 15948488..15948647 | 141..300 | 100 | -> | Plus |
Translation from 45 to 143
> GH07145.pep MQFSWMKVAIYLLTFLTYAYSGYGSSTIVHVS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24097-PA | 226 | GF24097-PA | 1..31 | 1..31 | 165 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15933-PA | 230 | GG15933-PA | 1..31 | 1..31 | 167 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14770-PA | 230 | GH14770-PA | 1..31 | 1..31 | 160 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GXIVsPLA2-PC | 32 | CG17035-PC | 1..32 | 1..32 | 166 | 100 | Plus |
GXIVsPLA2-PD | 230 | CG17035-PD | 1..31 | 1..31 | 159 | 96.8 | Plus |
GXIVsPLA2-PA | 230 | CG17035-PA | 1..31 | 1..31 | 159 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11872-PA | 228 | GI11872-PA | 1..31 | 1..31 | 161 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25215-PA | 228 | GL25215-PA | 1..31 | 1..31 | 161 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14287-PA | 228 | GA14287-PA | 1..31 | 1..31 | 161 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25562-PA | 230 | GM25562-PA | 1..31 | 1..31 | 167 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14577-PA | 230 | GD14577-PA | 1..31 | 1..31 | 167 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13568-PA | 228 | GJ13568-PA | 1..31 | 1..31 | 164 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16013-PA | 232 | GK16013-PA | 1..31 | 1..31 | 160 | 93.5 | Plus |
Translation from 398 to 742
> GH07145.hyp METCCNDHDICYDTCNSDKELCDLDFKRCLYKYCDSYEKSIASDLMMKGC KAAAKMLFTGTLTLGCRSYLDSQQRSCYCAPPKSSSYNGNRQGNSNSREK QQRQKYGWKDRNEI*