Clone GH07209 Report

Search the DGRC for GH07209

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:9
Vector:pOT2
Associated Gene/TranscriptCG13920-RA
Protein status:GH07209.pep: gold
Preliminary Size:1300
Sequenced Size:1231

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13920 2001-01-01 Release 2 assignment
CG13920 2003-01-01 Sim4 clustering to Release 3
CG13920 2003-02-17 Blastp of sequenced clone
CG13920 2008-04-29 Release 5.5 accounting
CG13920 2008-08-15 Release 5.9 accounting
CG13920 2008-12-18 5.12 accounting

Clone Sequence Records

GH07209.complete Sequence

1231 bp (1231 high quality bases) assembled on 2003-02-17

GenBank Submission: AY069059

> GH07209.complete
CTGCCGAAATAAACTTTGCAACTGCTCTGAATGTGAATCTGAATCCGAAT
CCGAGTCAGTCTCTTTCCGAACTGAAAGCGGAAAGGCGTCGAGTGAAAAT
GGAATAGGTGAAGGGAACGCCGCCGCGGACTAAAAATTCATAAACTTATA
CATACCGCAGCGATTTGAAAACTTGAAAACATTCGGATTGTGTGCCTCAA
TTTGCTGGTGGTCGCGTATTTTTCCGCATCGTCCGAATCGGCACGAAAAG
CTAAGAGATTCGTCTAAAATTAGCGACCGGTGTGTTTTGGTAGGGTGTTG
TATTGGCTAGGGGCTCCCAGTGAACTCCGCCCCTCCGAGTATTTACCCAT
AACCGGGCCAAGATGCCTCCTGCATCCAATACGATCGTGCTGAAGAGCCT
CTCCGTGCTGCTGGGCCTCTTCTTCATCTTCGTGGGCACCCTCAAGCTGA
CGCCGCACATTAGCAAGGATCTCTACAAGGACCTGCGCACAGAGTACGTG
AAGTATGCCAAAGTGTTCCCACTAACGGCGCTCTTCGGAGTGAAGATACC
CTCGAAATGGTACCGCCGCACCGTTGGCATCCTGGAGATCGTCTGCGGCC
TGGCCATGGCGCTGATTCCCTATCATAAGGTCAAAAACACGGCCAACGTT
ACGCTGCTGGTGTTGATGCTCCTGGGCATCTACCAGCACTGGATGGTCAG
TGATCCGTTCGAGCGCTCCGGTCCGGCGCTGGTCTTCACCTTCATGCTGG
GCGGACGCCTGGTGGTCTGGTACCAGACCGCCCGCCTCCAGGACGAGGCC
ACGACGGCAGCGCAGCCTGCTGCGAACGGCGTAAAGCAGGACTAGGTGCC
TGCTACCGGTGCATCACGTACTCATAGTCATTCACTGATCCAGCTTTGTT
TTAGCACCTTAAGTTGGGCTCGAGATGGCGCGCCCTGTCTGCGGGTCTCA
AATTCATTCACATCATTCTAGCAAATCGAAATTCATGTTTTCACTTTGGT
GCCAAATTATTATCGTATACAGAACTACTATATTGTATGCAATGGCGAGA
GATATTAACTAAACTGTAGACGCGACCAGATCAAACCAGAATGTAATCAA
ATCCTCTTCGTAACGGGCACTTAGTCGGAACCATTTAAATTACGACTTTA
GAAACAATTTTAATAAATTTGAACAACTCATACATATTTAAAATTAATAA
TCCAACGTCAGTCAAAAAAAAAAAAAAAAAA

GH07209.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13920.a 1598 CG13920.a 389..1598 1..1210 6050 100 Plus
CG13920-RA 1301 CG13920-RA 92..1301 1..1210 6050 100 Plus
CG7967-RA 1406 CG7967-RA 1234..1406 1215..1043 865 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1650508..1651096 625..1213 2930 99.8 Plus
chr3L 24539361 chr3L 1648616..1649100 1..485 2425 100 Plus
chr3L 24539361 chr3L 1650308..1650452 485..629 710 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:35:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1650913..1651503 625..1215 2955 100 Plus
3L 28110227 3L 1649023..1649507 1..485 2425 100 Plus
3L 28110227 3L 1650713..1650857 485..629 710 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1650913..1651503 625..1215 2955 100 Plus
3L 28103327 3L 1649023..1649507 1..485 2425 100 Plus
3L 28103327 3L 1650713..1650857 485..629 710 99.3 Plus
Blast to na_te.dros performed 2019-03-16 13:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Tirant 8526 Tirant TIRANT 8526bp 5577..5632 1150..1206 111 68.4 Plus

GH07209.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:47:32 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1648616..1649100 1..485 100 -> Plus
chr3L 1650309..1650447 486..624 100 -> Plus
chr3L 1650508..1651096 625..1213 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:22:28 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 1..483 363..845 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:56 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 1..483 363..845 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:06:10 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 1..483 363..845 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:51 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 1..483 363..845 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:30 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 1..483 363..845 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:06 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 81..1290 1..1210 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:56 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 81..1290 1..1210 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:06:10 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 18..1230 1..1213 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:51 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RA 81..1290 1..1210 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:30 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
CG13920-RC 80..1292 1..1213 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:32 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1649023..1649507 1..485 100 -> Plus
3L 1650714..1650852 486..624 100 -> Plus
3L 1650913..1651501 625..1213 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:32 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1649023..1649507 1..485 100 -> Plus
3L 1650714..1650852 486..624 100 -> Plus
3L 1650913..1651501 625..1213 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:32 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1649023..1649507 1..485 100 -> Plus
3L 1650714..1650852 486..624 100 -> Plus
3L 1650913..1651501 625..1213 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:06:10 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1649023..1649507 1..485 100 -> Plus
arm_3L 1650714..1650852 486..624 100 -> Plus
arm_3L 1650913..1651501 625..1213 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:09:26 Download gff for GH07209.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1649023..1649507 1..485 100 -> Plus
3L 1650714..1650852 486..624 100 -> Plus
3L 1650913..1651501 625..1213 100   Plus

GH07209.pep Sequence

Translation from 362 to 844

> GH07209.pep
MPPASNTIVLKSLSVLLGLFFIFVGTLKLTPHISKDLYKDLRTEYVKYAK
VFPLTALFGVKIPSKWYRRTVGILEIVCGLAMALIPYHKVKNTANVTLLV
LMLLGIYQHWMVSDPFERSGPALVFTFMLGGRLVVWYQTARLQDEATTAA
QPAANGVKQD*

GH07209.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24822-PA 159 GF24822-PA 2..159 3..160 802 95.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14811-PA 160 GG14811-PA 1..160 1..160 835 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15957-PA 160 GH15957-PA 2..160 3..160 701 87.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13920-PC 160 CG13920-PC 1..160 1..160 823 100 Plus
CG13920-PA 160 CG13920-PA 1..160 1..160 823 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16610-PA 160 GI16610-PA 2..160 3..160 703 86.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11921-PA 159 GL11921-PA 2..159 3..160 777 93.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12626-PA 159 GA12626-PA 2..159 3..160 777 93.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14433-PA 160 GM14433-PA 1..160 1..160 840 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13635-PA 160 GD13635-PA 1..160 1..160 840 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12864-PA 160 GJ12864-PA 2..160 3..160 702 87.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24408-PA 159 GK24408-PA 2..159 3..160 755 88.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21174-PA 160 GE21174-PA 1..160 1..160 830 98.1 Plus

GH07209.hyp Sequence

Translation from 362 to 844

> GH07209.hyp
MPPASNTIVLKSLSVLLGLFFIFVGTLKLTPHISKDLYKDLRTEYVKYAK
VFPLTALFGVKIPSKWYRRTVGILEIVCGLAMALIPYHKVKNTANVTLLV
LMLLGIYQHWMVSDPFERSGPALVFTFMLGGRLVVWYQTARLQDEATTAA
QPAANGVKQD*

GH07209.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13920-PC 160 CG13920-PC 1..160 1..160 823 100 Plus
CG13920-PA 160 CG13920-PA 1..160 1..160 823 100 Plus