Clone GH07295 Report

Search the DGRC for GH07295

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:95
Vector:pOT2
Associated Gene/TranscriptYippee-RA
Protein status:GH07295.pep: gold
Sequenced Size:977

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Yippee-RA 2010-01-15 Manual selection by Sue Celniker

Clone Sequence Records

GH07295.complete Sequence

977 bp assembled on 2010-02-11

GenBank Submission: BT120317.1

> GH07295.complete
CCTGACCAGGATTCCCCAAGTGGAGTCATCTTCAAACAGCTGTGAAAAAG
GAACAAAGGAGGAGCACAACAAACACACGCATACACACGTACGTACTCGG
GAGAGCGAGCGAGACGGGGTGCGACCAGAAGAGCGAGTGAGGTAGAGGAG
GGAGCACAATGGGACGCATTTTCTTGGAACATCTTGGGGGTCTGAAACTC
TTCAATTGCGCCCAATGCCACACGAACCTGACCAACCGCAGTCAATTGAT
CAGTACCCGATTCACAGGCGCAACAGGACGCGCCTATCTGTTTAAGCGTG
TGGTCAACCTGACCTTCAGCAACATCCAGGAACGGGTCATGCTCACGGGT
CGCCACATGGTGCGCGACGTTATGTGCAAGAATTGTGGAGCCAAACTTGG
CTGGATGTACGAGTTCGCCACCGAAGAGTCACAAAAATACAAGGAGGGTC
GCGTTATCCTGGAGTACGCCCTGATCACAGAGGCAGAGGGCTTTCCGTCG
GAGGCCGCCACCACGAGTCATTGAGCCGATTGAATATACAGCCGGAAAAC
GGGAACCACGCATTGGCGAACCTTGTGTAGCCCTAAGTATTGAGTAGATG
GCCACAGGCGATGGCCTCTATGCATTAGACCTAGATTAGAGATCGCCGTA
GTCGGCTCCGGTGTTCGGGATACCGAAGACCGATATATCGGTTGCACATC
CGCCACGGAGCACATGCGACTACGGCCCTGTCTTAACGTGACTTAAACGT
AATTGTAGGCACATCTAGCACGTAAGCAGCTGCGGCGCCCAATTCTACCA
TTTAAATGTCATGAGGCTGAAGTGCTAAAACGAAAAAGATGGGCTGCTAC
TCAGCTGGAACATATTCGAAACTGATGATCCACACTTGTCTTTTTCAAAC
AAGATCTCTAGGCCGTAATCAATCAGCAATAAAGTACCACAATAATCGAA
TAGTAGATAAAAAAAAAAAAAAAAAAA

GH07295.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-RA 1181 Yippee-RA 199..1158 1..960 4800 100 Plus
Yippee-RB 1308 Yippee-RB 762..1285 437..960 2620 100 Plus
Yippee-RB 1308 Yippee-RB 169..604 1..436 2180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13276685..13277206 958..437 2595 99.8 Minus
chrX 22417052 chrX 13277589..13277817 277..49 1145 100 Minus
chrX 22417052 chrX 13277364..13277527 436..273 820 100 Minus
chrX 22417052 chrX 13277960..13278010 51..1 240 98 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:36:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13385908..13386431 960..437 2620 100 Minus
X 23542271 X 13386814..13387042 277..49 1145 100 Minus
X 23542271 X 13386589..13386752 436..273 820 100 Minus
X 23542271 X 13387185..13387235 51..1 255 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13394006..13394529 960..437 2620 100 Minus
X 23527363 X 13394912..13395140 277..49 1145 100 Minus
X 23527363 X 13394687..13394850 436..273 820 100 Minus
X 23527363 X 13395283..13395333 51..1 255 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:10:04 has no hits.

GH07295.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:10:53 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13276685..13277206 437..958 99 <- Minus
chrX 13277364..13277523 277..436 100 <- Minus
chrX 13277590..13277815 51..276 100 <- Minus
chrX 13277961..13278010 1..50 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 12:43:10 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 1..366 159..524 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:24:34 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 1..366 159..524 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:39:34 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 1..366 159..524 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:45:27 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 1..366 159..524 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 12:43:09 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 160..1113 1..954 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:24:33 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 160..1113 1..954 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:39:34 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 160..1113 1..954 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:27 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RA 183..1136 1..954 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:53 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385910..13386431 437..958 100 <- Minus
X 13386589..13386748 277..436 100 <- Minus
X 13386815..13387040 51..276 100 <- Minus
X 13387186..13387235 1..50 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:53 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385910..13386431 437..958 100 <- Minus
X 13386589..13386748 277..436 100 <- Minus
X 13386815..13387040 51..276 100 <- Minus
X 13387186..13387235 1..50 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:53 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385910..13386431 437..958 100 <- Minus
X 13386589..13386748 277..436 100 <- Minus
X 13386815..13387040 51..276 100 <- Minus
X 13387186..13387235 1..50 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:39:34 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13279943..13280464 437..958 100 <- Minus
arm_X 13280622..13280781 277..436 100 <- Minus
arm_X 13280848..13281073 51..276 100 <- Minus
arm_X 13281219..13281268 1..50 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:42 Download gff for GH07295.complete
Subject Subject Range Query Range Percent Splice Strand
X 13394008..13394529 437..958 100 <- Minus
X 13394687..13394846 277..436 100 <- Minus
X 13394913..13395138 51..276 100 <- Minus
X 13395284..13395333 1..50 100   Minus

GH07295.pep Sequence

Translation from 158 to 523

> GH07295.pep
MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVN
LTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVI
LEYALITEAEGFPSEAATTSH*

GH07295.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19499-PA 121 GF19499-PA 1..121 1..121 638 98.3 Plus
Dana\GF19108-PA 114 GF19108-PA 14..113 13..112 249 45 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19506-PA 121 GG19506-PA 1..121 1..121 646 100 Plus
Dere\GG18944-PA 114 GG18944-PA 14..113 13..112 249 45 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24471-PA 121 GH24471-PA 1..121 1..121 612 95 Plus
Dgri\GH24074-PA 114 GH24074-PA 14..113 13..112 249 45 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-PA 121 CG1989-PA 1..121 1..121 635 100 Plus
Yippee-PB 110 CG1989-PB 1..94 1..94 496 98.9 Plus
CG15309-PE 114 CG15309-PE 14..113 13..112 244 45 Plus
CG15309-PD 114 CG15309-PD 14..113 13..112 244 45 Plus
CG15309-PC 114 CG15309-PC 14..113 13..112 244 45 Plus
CG15309-PB 114 CG15309-PB 14..113 13..112 244 45 Plus
CG15309-PA 114 CG15309-PA 14..113 13..112 244 45 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15336-PA 121 GI15336-PA 1..121 1..121 619 95.9 Plus
Dmoj\GI15523-PA 114 GI15523-PA 14..113 13..112 249 45 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26724-PA 121 GL26724-PA 1..121 1..121 632 96.7 Plus
Dper\GL22456-PA 114 GL22456-PA 14..113 13..112 246 45 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15174-PA 121 GA15174-PA 1..121 1..121 632 96.7 Plus
Dpse\GA27919-PA 114 GA27919-PA 14..113 13..112 249 45 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11494-PA 121 GM11494-PA 1..121 1..121 646 100 Plus
Dsec\GM11334-PA 114 GM11334-PA 14..113 13..112 249 45 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15888-PA 121 GD15888-PA 1..121 1..121 646 100 Plus
Dsim\GD24655-PA 114 GD24655-PA 14..113 13..112 249 45 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14773-PA 121 GJ14773-PA 1..121 1..121 619 95.9 Plus
Dvir\GJ19280-PA 114 GJ19280-PA 14..113 13..112 249 45 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25643-PA 121 GK25643-PA 1..121 1..121 615 94.2 Plus
Dwil\GK20038-PA 114 GK20038-PA 14..113 13..112 249 45 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16160-PA 121 GE16160-PA 1..121 1..121 641 99.2 Plus
Dyak\GE15414-PA 114 GE15414-PA 14..113 13..112 249 45 Plus

GH07295.hyp Sequence

Translation from 158 to 523

> GH07295.hyp
MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVN
LTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVI
LEYALITEAEGFPSEAATTSH*

GH07295.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-PA 121 CG1989-PA 1..121 1..121 635 100 Plus
Yippee-PB 110 CG1989-PB 1..94 1..94 496 98.9 Plus
CG15309-PE 114 CG15309-PE 14..113 13..112 244 45 Plus
CG15309-PD 114 CG15309-PD 14..113 13..112 244 45 Plus
CG15309-PC 114 CG15309-PC 14..113 13..112 244 45 Plus