Clone GH07296 Report

Search the DGRC for GH07296

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:96
Vector:pOT2
Associated Gene/TranscriptCG5762-RA
Protein status:GH07296.pep: gold
Preliminary Size:1076
Sequenced Size:945

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5762 2001-01-01 Release 2 assignment
CG5762 2002-01-03 Blastp of sequenced clone
CG5762 2003-01-01 Sim4 clustering to Release 3
CG5762 2008-04-29 Release 5.5 accounting
CG5762 2008-08-15 Release 5.9 accounting
CG5762 2008-12-18 5.12 accounting

Clone Sequence Records

GH07296.complete Sequence

945 bp (945 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075317

> GH07296.complete
AGCGGATTCAGTTCGTTACACGCCGCCTCTTTGGAAGCAGGCTACATTTT
GGCATTCCAATACTAAAACTTACACAATTCCCTAATTCTTTTAATAAAAT
TTCTAAAACTGTAAAAAAAAAAAAAATATCTTCCGAGAATGGTTAACATC
CACGGTGGCACTCGGATGATGGTGAACCGTTGCATCGAGCTCCTCCGTGC
GCGGATCGAATGCGCCTCAACGCGTCACATTGCCAGGCGTTCCCAGCGGC
CCAGAGTGGGCAGCCAATACCTGCCAGACGATCAGATACTCAGGGAGCGG
GAGAAAGCGGATGTGTACAAGAAGAACAAGCGACGCTCCATGTGGGAGCA
GGACGAGGGCCACGGACGCATCTCGGTCGGGGACGATCAGGAACGCTTCG
ATAACGAGCAGTACCATCCGCGCGAACTGGAGAAGCGCAAGTACGAGTGC
ACCTGGGTTAATTTCCCGGACAGTGTGGCGACCAAACGAAATCGTAGACG
GGACTTTCTGGAGTCGATGGAAACTGAGGCTCCTCGACGCCGCCGAGCCC
AGGAAGAAAGACCGAGTACGGCAAAGCCATGTGACGACGAGGCCCGTGCC
TTTATCAACCAATGGGACACCAATGCGGCGATGATCCAACGCAACAAATT
TGCTCGTGCCACCGATAGCTGTCCACCACCCATTGTATCTCTCCGGTTGT
CAAACGCCTACAGCACCCGAAAACGTCAGTTCTTATTCTAAACCGTTTAT
ATTTGACAGTTGTATTCGCATCAGAAATTCTAGCAATCGCTCATTCTTGT
AGCCTGATCAAATTGATAGTGTCGAAGGCATCAGATTTTAAAGCGTCCAA
ATCCGAAAATGTAACTGTAAAAATGTAACACATCTGCACTAGATGTGATA
TTTGTTACTAATAAAATATTTAAGTGTAAAAAAAAAAAAAAAAAA

GH07296.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5762-RA 943 CG5762-RA 1..928 1..928 4640 100 Plus
CG5762.b 924 CG5762.b 1..924 1..928 4555 99.5 Plus
CG5762.a 864 CG5762.a 1..695 1..695 3475 100 Plus
CG5762.a 864 CG5762.a 695..864 759..928 850 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20184469..20185023 553..1 2650 99.3 Minus
chr3R 27901430 chr3R 20184037..20184414 927..550 1890 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:36:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24361137..24361689 553..1 2765 100 Minus
3R 32079331 3R 24360704..24361082 928..550 1895 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24101968..24102520 553..1 2765 100 Minus
3R 31820162 3R 24101535..24101913 928..550 1895 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:36:52 has no hits.

GH07296.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:37:44 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20184037..20184411 553..927 100 <- Minus
chr3R 20184470..20185023 1..552 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:22:54 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..603 139..741 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:06 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..603 139..741 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:54:19 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..603 139..741 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:21:55 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..603 139..741 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:59:11 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..603 139..741 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:21:35 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:06 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:54:19 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..921 7..927 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:21:55 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..927 1..927 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:59:11 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
CG5762-RA 1..921 7..927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:44 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24360705..24361079 553..927 100 <- Minus
3R 24361138..24361689 1..552 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:44 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24360705..24361079 553..927 100 <- Minus
3R 24361138..24361689 1..552 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:44 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24360705..24361079 553..927 100 <- Minus
3R 24361138..24361689 1..552 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:54:19 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20186427..20186801 553..927 100 <- Minus
arm_3R 20186860..20187411 1..552 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:56:45 Download gff for GH07296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24101536..24101910 553..927 100 <- Minus
3R 24101969..24102520 1..552 100   Minus

GH07296.hyp Sequence

Translation from 138 to 740

> GH07296.hyp
MVNIHGGTRMMVNRCIELLRARIECASTRHIARRSQRPRVGSQYLPDDQI
LREREKADVYKKNKRRSMWEQDEGHGRISVGDDQERFDNEQYHPRELEKR
KYECTWVNFPDSVATKRNRRRDFLESMETEAPRRRRAQEERPSTAKPCDD
EARAFINQWDTNAAMIQRNKFARATDSCPPPIVSLRLSNAYSTRKRQFLF
*

GH07296.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5762-PA 200 CG5762-PA 1..200 1..200 1063 100 Plus

GH07296.pep Sequence

Translation from 138 to 740

> GH07296.pep
MVNIHGGTRMMVNRCIELLRARIECASTRHIARRSQRPRVGSQYLPDDQI
LREREKADVYKKNKRRSMWEQDEGHGRISVGDDQERFDNEQYHPRELEKR
KYECTWVNFPDSVATKRNRRRDFLESMETEAPRRRRAQEERPSTAKPCDD
EARAFINQWDTNAAMIQRNKFARATDSCPPPIVSLRLSNAYSTRKRQFLF
*

GH07296.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20719-PA 196 GF20719-PA 1..196 1..200 513 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12350-PA 205 GG12350-PA 1..205 1..200 960 89.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18794-PA 115 GH18794-PA 1..109 1..111 231 42.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5762-PA 200 CG5762-PA 1..200 1..200 1063 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22685-PA 191 GI22685-PA 1..191 1..199 327 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20769-PA 297 GL20769-PA 165..287 9..160 224 39.9 Plus
Dper\GL21986-PA 103 GL21986-PA 1..98 19..159 142 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28316-PA 151 GA28316-PA 7..110 27..159 162 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23490-PA 201 GM23490-PA 1..201 1..200 997 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18296-PA 201 GD18296-PA 1..201 1..200 994 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23412-PA 193 GJ23412-PA 1..193 1..200 380 42.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10803-PA 206 GE10803-PA 1..206 1..200 953 88.3 Plus