Clone GH07301 Report

Search the DGRC for GH07301

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:73
Well:1
Vector:pOT2
Associated Gene/TranscriptCG9119-RA
Protein status:GH07301.pep: gold
Preliminary Size:2200
Sequenced Size:1198

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9119 2001-01-01 Release 2 assignment
CG9119 2001-09-19 Blastp of sequenced clone
CG9119 2003-01-01 Sim4 clustering to Release 3
CG9119 2008-04-29 Release 5.5 accounting
CG9119 2008-08-15 Release 5.9 accounting
CG9119 2008-12-18 5.12 accounting

Clone Sequence Records

GH07301.complete Sequence

1198 bp (1198 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058311

> GH07301.complete
CGGTAGGTAGCCTCAGCGCGACTAGAATACTTGGTGGGCTAGAGAAAGGA
ATCCAAACCTGAATCGGAACGAGGCCAGAATCGCAATAAGGAGCAAAGTA
ACTAGGACACATCTCCAACCAAAATGAGCCAGAACCAACTGAGTACGGAG
CAACTGCTCTTCGAGGAGAAGCCGCTGTACGTGCCCCCATTGTCAGAGTT
GCAGAACGTTATACAGGGTGCCCTGGCGGCCAACTTCGCCAATGTGAATG
TCAGTGTGGGCCCTTGTCCGGATCTGAAGGCCAAGCAGTTCGGCCTGGTG
GAGAGTGGACTGGGCGGCAAGCCCACGCTGCTGGAGGCGGGAGGCCCACC
CTTTCTGCTGCCCCTCGTGCAGCGAGATAAGCTGTACAACATCGCCGAGA
TCACGCGAAAGATCCAGGGCCCCGGCACGGTGTTCGCCGTGGGCGCCGGA
GCGGGACCTTGGCCCATCCGGGGATCCAACTGCGAGGGCATCTTCAACTT
GTCCGTGAACGAGAAGGATGAGCTCACGAACGGCAGCTACACGGCCACTG
TGAGGGGAGAGCAGGAGGAGTGCGTCCTGGAGAAGATACCCCACACAGAG
CCCAGGTGCGCCCTGCTTCTCAACCTCTTCCTCAGCCAGGGCAAGCCTGG
TCAGGTGTTGAAAATCACCGCCAAGCAGCGCACTGGCGAACAGAACTTCA
TCGAGTGCATCCGCAAGGGCCTGGAGAACCACTACGGGGACAAGGTGGTG
GGTCTGGGTGGCATTTTTCTGATCAAGAAGGGCGCTGCCCACCAGCACGT
GATGCGGGACTTCAGCAAGACGCCCATCAACAGCGACGAGGAGGTGAACG
AGTGGCTCAAGTTCTACGAGATGCCCGCCCAGCTGAACGCCGTGGGCACG
CTGGTGACCAAGGAGCACGACCTGGACCTTCGCCTGCAGCACTTCCACTC
CTTCTCCTTCAGCAACTGGGGCGGTCACTACCATTACGACACCACGCCGG
ATATCGTTGAGTACGAGGCCTACCTGAACGTAGCCGAACGGGTGGTGCGG
GTGGATAAGCCCGTGGCCACTCACAAAGTGGGACGCGACTAGATCTTATC
TGCCGTATCTAGTTGTAGCCGACTTTTCCATTGCCCCAACCCCCAATAAA
TAATAGTAAATAAACAAAACATAAGCTCGAAAAAAAAAAAAAAAAAAA

GH07301.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9119-RA 1374 CG9119-RA 123..1305 1..1183 5915 100 Plus
CG32335-RB 1211 CG32335-RB 914..1122 859..1067 520 83.2 Plus
CG32335-RB 1211 CG32335-RB 677..887 622..832 320 76.7 Plus
CG32335-RB 1211 CG32335-RB 303..444 248..389 290 80.2 Plus
CG32335-RB 1211 CG32335-RB 503..646 448..591 225 77 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1202838..1203809 1179..208 4755 99.3 Minus
chr3L 24539361 chr3L 1201465..1202284 1067..248 1100 75.6 Minus
chr3L 24539361 chr3L 1204077..1204284 208..1 980 98.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:36:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1203312..1204287 1183..208 4880 100 Minus
3L 28110227 3L 1201939..1202758 1067..248 1115 75.7 Minus
3L 28110227 3L 1204555..1204762 208..1 1040 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1203312..1204287 1183..208 4880 100 Minus
3L 28103327 3L 1204555..1204762 208..1 1040 100 Minus
3L 28103327 3L 1201939..1202084 1067..922 370 83.5 Minus
3L 28103327 3L 1202174..1202384 832..622 320 76.7 Minus
3L 28103327 3L 1202617..1202758 389..248 290 80.2 Minus
3L 28103327 3L 1202415..1202558 591..448 225 77 Minus
3L 28103327 3L 1202092..1202147 914..859 205 91 Minus
Blast to na_te.dros performed on 2019-03-15 12:03:09 has no hits.

GH07301.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:04:09 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1202838..1203808 209..1179 99 <- Minus
chr3L 1204077..1204284 1..208 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:22:56 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 1..969 124..1092 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:09:14 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 1..969 124..1092 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:36:46 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 1..969 124..1092 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:40:09 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 1..969 124..1092 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:50:33 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 1..969 124..1092 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:00:08 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 31..1209 1..1179 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:09:14 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 31..1209 1..1179 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:36:46 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 34..1212 1..1179 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:40:09 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 31..1209 1..1179 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:50:33 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
CG9119-RA 34..1212 1..1179 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:04:09 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1203316..1204286 209..1179 100 <- Minus
3L 1204555..1204762 1..208 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:04:09 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1203316..1204286 209..1179 100 <- Minus
3L 1204555..1204762 1..208 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:04:09 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1203316..1204286 209..1179 100 <- Minus
3L 1204555..1204762 1..208 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:36:46 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1203316..1204286 209..1179 100 <- Minus
arm_3L 1204555..1204762 1..208 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:17:38 Download gff for GH07301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1203316..1204286 209..1179 100 <- Minus
3L 1204555..1204762 1..208 100   Minus

GH07301.hyp Sequence

Translation from 123 to 1091

> GH07301.hyp
MSQNQLSTEQLLFEEKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPD
LKAKQFGLVESGLGGKPTLLEAGGPPFLLPLVQRDKLYNIAEITRKIQGP
GTVFAVGAGAGPWPIRGSNCEGIFNLSVNEKDELTNGSYTATVRGEQEEC
VLEKIPHTEPRCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGL
ENHYGDKVVGLGGIFLIKKGAAHQHVMRDFSKTPINSDEEVNEWLKFYEM
PAQLNAVGTLVTKEHDLDLRLQHFHSFSFSNWGGHYHYDTTPDIVEYEAY
LNVAERVVRVDKPVATHKVGRD*

GH07301.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9119-PA 322 CG9119-PA 1..322 1..322 1699 100 Plus
CG32335-PB 322 CG32335-PB 1..322 1..322 1350 76.7 Plus

GH07301.pep Sequence

Translation from 123 to 1091

> GH07301.pep
MSQNQLSTEQLLFEEKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPD
LKAKQFGLVESGLGGKPTLLEAGGPPFLLPLVQRDKLYNIAEITRKIQGP
GTVFAVGAGAGPWPIRGSNCEGIFNLSVNEKDELTNGSYTATVRGEQEEC
VLEKIPHTEPRCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGL
ENHYGDKVVGLGGIFLIKKGAAHQHVMRDFSKTPINSDEEVNEWLKFYEM
PAQLNAVGTLVTKEHDLDLRLQHFHSFSFSNWGGHYHYDTTPDIVEYEAY
LNVAERVVRVDKPVATHKVGRD*

GH07301.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10074-PA 648 GF10074-PA 4..319 3..318 1609 94.3 Plus
Dana\GF10075-PA 335 GF10075-PA 1..319 1..319 1425 82.1 Plus
Dana\GF10074-PA 648 GF10074-PA 334..646 2..314 1310 76.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14618-PA 322 GG14618-PA 1..322 1..322 1687 97.8 Plus
Dere\GG14619-PA 322 GG14619-PA 1..322 1..322 1343 75.2 Plus
Dere\GG19819-PA 115 GG19819-PA 1..115 1..115 550 93 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15990-PA 324 GH15990-PA 3..324 2..322 1397 80.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG9119-PA 322 CG9119-PA 1..322 1..322 1699 100 Plus
CG32335-PB 322 CG32335-PB 1..322 1..322 1350 76.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16644-PA 322 GI16644-PA 1..322 1..322 1462 82.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16084-PA 221 GL16084-PA 49..221 150..322 899 93.6 Plus
Dper\GL16084-PA 221 GL16084-PA 6..43 2..39 159 81.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21557-PA 326 GA21557-PA 6..326 2..322 1547 89.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14230-PA 322 GM14230-PA 1..322 1..322 1701 98.8 Plus
Dsec\GM14231-PA 322 GM14231-PA 1..322 1..322 1336 74.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13491-PA 322 GD13491-PA 1..322 1..322 1684 98.1 Plus
Dsim\GD13492-PA 322 GD13492-PA 1..322 1..322 1372 76.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12897-PA 326 GJ12897-PA 10..326 6..322 1436 83.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12347-PA 322 GK12347-PA 1..322 1..322 1558 89.8 Plus
Dwil\GK12404-PA 323 GK12404-PA 1..314 1..313 1344 78.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20978-PA 322 GE20978-PA 1..322 1..322 1704 98.8 Plus
Dyak\GE20980-PA 322 GE20980-PA 1..322 1..322 1384 77.3 Plus