Clone GH07575 Report

Search the DGRC for GH07575

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:75
Well:75
Vector:pOT2
Associated Gene/TranscriptCG10912-RA
Protein status:GH07575.pep: gold
Preliminary Size:1063
Sequenced Size:903

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10912 2001-01-01 Release 2 assignment
CG10912 2001-11-29 Blastp of sequenced clone
CG10912 2003-01-01 Sim4 clustering to Release 3
CG10912 2008-04-29 Release 5.5 accounting
CG10912 2008-08-15 Release 5.9 accounting
CG10912 2008-12-18 5.12 accounting

Clone Sequence Records

GH07575.complete Sequence

903 bp (903 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069060

> GH07575.complete
AGCAACATGCAGTCACATCTCATCGCCATCCTGCTGGCCACCGTGGCCAT
TGGCTCCTGCATCGCGAATCCCAACCTCATCTCTGGTCCTTCGCGAATTC
TTGAGATAATGAGCGCCACCAGTGATATCCAGCGTAATAATCCACAACTG
ACCGTAGAATGTTTTGACTACTATAATGACGTATTCAAAACCGAGTATGC
GGAGTATGTGGATGAGTACAATCTGTGCGTCGATAAGTATGATGGCGGTT
ATGAACAGGTTCTGGAACAGTACAATTCCGTTGTCTGGGACCTCAGCAAT
TCCACCTTCGAATCCTGCATGTTCCTGCTGGACTGCGATAAACAGAATAA
CAGCGAAAATGCTCTATCCTGCTACTCCACTGAGGGTCCGACATATTCCA
AGCAGTTGTCGAATGTGGCAGCCAATGCTTCGGTCTCGGTCAGTTCACTG
CGTCAGCAGGTCGAAACACTGGTGTTCACCCGTGACCAATGCTGTTCTGC
AACGTCCAGGAACTATGAGATCCGCTCCGGCGAGTCCTACGAAGATCTTC
AGAAGTGCCTGAGCGGTGAGAATCCTGTGCCGGAAAGAAGCACCACCACT
ACCAGTTCCAGCTCCAGCTCCAGCACCAGCACCACCGCCGCCAACCCCAC
TACTACCACCACGACCCCATCTCCTTCAACCACCACCTCATCGTCTTCCA
CCTCCTCAACAACGAGATCTCCATCGACAGTTGCGCATTTTAGTTCCGTT
GAAAACAGCAGTGGCAACAGCCAGCACCGATTTCCAAGAAGACTGGACAA
TATTTTCAAACATATTCTTTAAGGGTTGAACAATATAAAAGTCAATATCA
ATAAACTAAAAAGGAACATTGCAAAAAGACAAAAAAAAAAAAAAAAAAAA
AAA

GH07575.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG10912-RA 1050 CG10912-RA 124..1005 1..882 4410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13943185..13943682 880..383 2430 99.2 Minus
chr2R 21145070 chr2R 13943772..13944156 385..1 1880 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:36:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18056062..18056561 882..383 2500 100 Minus
2R 25286936 2R 18056651..18057035 385..1 1925 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18057261..18057760 882..383 2500 100 Minus
2R 25260384 2R 18057850..18058234 385..1 1925 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:01:20 has no hits.

GH07575.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:02:10 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13943185..13943398 667..880 99 == Minus
chr2R 13943475..13943680 385..590 98 <- Minus
chr2R 13943773..13944156 1..384 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:23:52 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 1..816 7..822 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:23 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 1..816 7..822 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:55:31 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 1..816 7..822 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:57 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 1..816 7..822 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:18:40 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 1..816 7..822 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:04:13 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 25..904 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:23 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 25..904 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:55:31 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 31..910 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:54:58 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 25..904 1..880 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:18:40 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
CG10912-RA 31..910 1..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:10 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18056064..18056559 385..880 100 <- Minus
2R 18056652..18057035 1..384 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:10 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18056064..18056559 385..880 100 <- Minus
2R 18056652..18057035 1..384 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:02:10 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18056064..18056559 385..880 100 <- Minus
2R 18056652..18057035 1..384 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:55:31 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13943569..13944064 385..880 100 <- Minus
arm_2R 13944157..13944540 1..384 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:30:59 Download gff for GH07575.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18057263..18057758 385..880 100 <- Minus
2R 18057851..18058234 1..384 100   Minus

GH07575.hyp Sequence

Translation from 1 to 821

> GH07575.hyp
SNMQSHLIAILLATVAIGSCIANPNLISGPSRILEIMSATSDIQRNNPQL
TVECFDYYNDVFKTEYAEYVDEYNLCVDKYDGGYEQVLEQYNSVVWDLSN
STFESCMFLLDCDKQNNSENALSCYSTEGPTYSKQLSNVAANASVSVSSL
RQQVETLVFTRDQCCSATSRNYEIRSGESYEDLQKCLSGENPVPERSTTT
TSSSSSSSTSTTAANPTTTTTTPSPSTTTSSSSTSSTTRSPSTVAHFSSV
ENSSGNSQHRFPRRLDNIFKHIL*

GH07575.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG10912-PA 271 CG10912-PA 1..271 3..273 1394 100 Plus
CG10911-PA 359 CG10911-PA 5..257 7..257 273 30.2 Plus
CG31041-PA 198 CG31041-PA 1..188 3..191 236 28.4 Plus
CG7567-PA 211 CG7567-PA 7..203 7..198 229 28.3 Plus
CG16762-PA 254 CG16762-PA 16..239 7..225 193 25.9 Plus

GH07575.pep Sequence

Translation from 6 to 821

> GH07575.pep
MQSHLIAILLATVAIGSCIANPNLISGPSRILEIMSATSDIQRNNPQLTV
ECFDYYNDVFKTEYAEYVDEYNLCVDKYDGGYEQVLEQYNSVVWDLSNST
FESCMFLLDCDKQNNSENALSCYSTEGPTYSKQLSNVAANASVSVSSLRQ
QVETLVFTRDQCCSATSRNYEIRSGESYEDLQKCLSGENPVPERSTTTTS
SSSSSSTSTTAANPTTTTTTPSPSTTTSSSSTSSTTRSPSTVAHFSSVEN
SSGNSQHRFPRRLDNIFKHIL*

GH07575.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13207-PA 263 GF13207-PA 1..262 1..271 391 38.7 Plus
Dana\GF22881-PA 228 GF22881-PA 6..200 3..193 189 27.4 Plus
Dana\GF13208-PA 377 GF13208-PA 1..237 1..238 165 26 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20996-PA 284 GG20996-PA 1..283 1..270 859 63.1 Plus
Dere\GG12012-PA 198 GG12012-PA 1..188 1..189 219 28.4 Plus
Dere\GG12014-PA 210 GG12014-PA 7..203 5..196 216 27.6 Plus
Dere\GG20997-PA 383 GG20997-PA 5..199 6..200 146 23.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20448-PA 278 GH20448-PA 1..188 1..191 157 22 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG10912-PA 271 CG10912-PA 1..271 1..271 1394 100 Plus
CG10911-PA 359 CG10911-PA 5..257 5..255 273 30.2 Plus
CG31041-PA 198 CG31041-PA 1..188 1..189 236 28.4 Plus
CG7567-PA 211 CG7567-PA 7..203 5..196 229 28.3 Plus
CG16762-PA 254 CG16762-PA 16..239 5..223 193 25.9 Plus
CG5767-PA 253 CG5767-PA 48..252 48..255 183 23 Plus
CG5770-PA 213 CG5770-PA 46..204 48..210 173 25.8 Plus
CG11470-PB 230 CG11470-PB 31..227 29..223 157 21.4 Plus
CG11470-PA 230 CG11470-PA 31..227 29..223 157 21.4 Plus
Muc55B-PB 485 CG5765-PB 6..253 5..239 151 23.6 Plus
Muc55B-PA 485 CG5765-PA 6..253 5..239 151 23.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19276-PA 375 GI19276-PA 18..187 27..198 254 30.8 Plus
Dmoj\GI19278-PA 253 GI19278-PA 5..203 6..210 163 23.9 Plus
Dmoj\GI24460-PA 223 GI24460-PA 1..190 1..188 143 25.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10539-PA 259 GL10539-PA 28..259 25..271 310 33.2 Plus
Dper\GL13587-PA 220 GL13587-PA 31..188 30..187 158 24.1 Plus
Dper\GL13585-PA 197 GL13585-PA 24..187 25..189 153 23 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10636-PA 259 GA10636-PA 28..259 25..271 325 33.6 Plus
Dpse\GA15961-PA 197 GA15961-PA 24..187 25..189 153 23 Plus
Dpse\GA26834-PA 218 GA26834-PA 31..188 30..187 153 23.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19930-PA 246 GM19930-PA 1..246 1..271 917 76 Plus
Dsec\GM12239-PA 211 GM12239-PA 7..204 5..197 217 28.6 Plus
Dsec\GM12237-PA 157 GM12237-PA 6..144 48..186 179 31.7 Plus
Dsec\GM19931-PA 366 GM19931-PA 1..197 1..198 177 27.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25419-PA 287 GD25419-PA 1..287 1..271 1017 77.4 Plus
Dsim\GD17731-PA 199 GD17731-PA 11..192 17..197 206 28.4 Plus
Dsim\GD17724-PA 198 GD17724-PA 47..185 48..186 198 32.4 Plus
Dsim\GD25420-PA 381 GD25420-PA 1..197 1..198 175 27.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22154-PA 332 GJ22154-PA 23..241 27..239 285 30.6 Plus
Dvir\GJ10550-PA 211 GJ10550-PA 2..188 5..188 169 26.1 Plus
Dvir\GJ22155-PA 276 GJ22155-PA 5..276 6..250 167 21.9 Plus
Dvir\GJ10549-PA 211 GJ10549-PA 2..188 5..188 165 26.1 Plus
Dvir\GJ10551-PA 211 GJ10551-PA 5..208 6..207 159 25.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22057-PA 259 GK22057-PA 10..240 9..239 337 32.9 Plus
Dwil\GK12381-PA 218 GK12381-PA 1..195 25..218 279 34.9 Plus
Dwil\GK17899-PA 237 GK17899-PA 39..237 30..224 187 25 Plus
Dwil\GK11180-PA 229 GK11180-PA 61..198 52..188 163 26.1 Plus
Dwil\GK22059-PA 340 GK22059-PA 28..185 31..192 160 23.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13939-PA 272 GE13939-PA 1..272 1..271 828 60 Plus
Dyak\GE10450-PA 211 GE10450-PA 6..204 3..196 201 25.5 Plus
Dyak\GE10448-PA 198 GE10448-PA 47..188 48..189 197 30.3 Plus
Dyak\GE13940-PA 406 GE13940-PA 1..191 1..192 173 26.8 Plus