Clone GH07855 Report

Search the DGRC for GH07855

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:78
Well:55
Vector:pOT2
Associated Gene/TranscriptCG8701-RA
Protein status:GH07855.pep: gold
Preliminary Size:1300
Sequenced Size:1083

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8701 2001-01-01 Release 2 assignment
CG8701 2001-10-10 Blastp of sequenced clone
CG8701 2003-01-01 Sim4 clustering to Release 3
CG8701 2008-04-29 Release 5.5 accounting
CG8701 2008-08-15 Release 5.9 accounting
CG8701 2008-12-18 5.12 accounting

Clone Sequence Records

GH07855.complete Sequence

1083 bp (1083 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060648

> GH07855.complete
TCGGCCTCTTCCAAAATTCACATCGGCTCCGTTGAGCTGATTGTGTATTC
GGTTACAAATTTGTAGTTTGGTCATTTTTCGGTGCCGAGGGATTTTCATT
TTTGTTTCGGGATTGTTGTATTTAGCGATACCTTTCTTTCCCCCCCGAGA
AATTTATATCAGCCCGTATCCAGCCATGTCTATGTGGCGCAGTATTGGAA
CGAAAACCCAAAATCGAGTAATACCCAGCTTTGCGAGCGTGGTCTGCCAT
CGCGCTTTCGCAAAGGACCACAATCCATCTCCAAAGTGCAGTGACAGTTC
TGGAAAGGGTTGCGGTAATTTTACCGCTTGTGGAGACCCCCGGTTCGCGA
AGAAACCACCGCCGAAGAAGGAGGACGGCTTCCAGTTCCATCATCTGGTG
AAGCAGCCGCCGGAGTGCTGCACCGATCCCTGCGCGGAACGGTTCCCCCC
GTACGACCAATGCTACTACAAGATCTCTGACAAGGCCACGCGCAAGTACC
AGGTCACCTGGGTGGAGTGTCCGCCCATAAAGATAAAGCCCAAGAAGATC
TGCTGCTACGAGGCGGGAATTCGTCCGCCGATCCCAAGGCGCAAGCGCAA
GAAGTTCGTGACATCCGCCGAGTGTCCCACGAATGTCGAATGCCCCACGG
AGGGAGGACCCTGCCCTAGAATCAAGATGCCCGGCTGTAAGGCCGTAGAC
AGCGTCTCTTGCCACGTCGTTAGACGTAAGACCGACTGCGTCAAAGTCAA
GGCCCCCTATCCTTCCTTCTCCGAGTGCAGCCGCTCTCGTCTTCGCAAGC
CTCGGGGCGTTGAATGCAACTGCCTAGATGTTCCAAGCTCCTGTGACCTG
ATTCGTGAGCTGAAGAAGTTCGAAGGAAATCCACGGAAGCCAAACTGCGG
GGGCAGTAGGGCTTAATTCCATAGTGCTGTTTGAATCCTAATCCCAGCGC
TCAGTATCTTGTTCCGTTGACCTAAATATTCCAAACCGATCCAGTTAAAG
TAACTTTTCTACCGTGCGTAAAATTCAGACTAGAAATAAACCGAACTATG
ATTTTTAAATTTATTTAAAAAAAAAAAAAAAAA

GH07855.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8701-RA 1079 CG8701-RA 5..1072 1..1068 5340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4258602..4259667 1..1066 5315 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:37:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8371077..8372144 1..1068 5340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8372276..8373343 1..1068 5340 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:21:40 has no hits.

GH07855.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:23:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4258602..4259651 1..1050 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:25:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 1..741 176..916 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:37:48 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 1..741 176..916 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 1..741 176..916 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:06:43 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 1..741 176..916 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:17:52 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 1..741 176..916 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:18:38 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 5..1070 1..1066 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:37:48 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 5..1070 1..1066 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 5..1070 1..1066 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:06:43 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 5..1070 1..1066 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:52 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
CG8701-RA 5..1070 1..1066 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8371077..8372142 1..1066 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8371077..8372142 1..1066 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8371077..8372142 1..1066 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:06 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4258582..4259647 1..1066 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:42:43 Download gff for GH07855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8372276..8373341 1..1066 100   Plus

GH07855.pep Sequence

Translation from 175 to 915

> GH07855.pep
MSMWRSIGTKTQNRVIPSFASVVCHRAFAKDHNPSPKCSDSSGKGCGNFT
ACGDPRFAKKPPPKKEDGFQFHHLVKQPPECCTDPCAERFPPYDQCYYKI
SDKATRKYQVTWVECPPIKIKPKKICCYEAGIRPPIPRRKRKKFVTSAEC
PTNVECPTEGGPCPRIKMPGCKAVDSVSCHVVRRKTDCVKVKAPYPSFSE
CSRSRLRKPRGVECNCLDVPSSCDLIRELKKFEGNPRKPNCGGSRA*

GH07855.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12352-PA 229 GF12352-PA 1..227 22..244 649 66.7 Plus
Dana\GF12592-PA 303 GF12592-PA 144..288 93..231 253 42.8 Plus
Dana\GF20746-PA 237 GF20746-PA 87..226 91..231 228 43.4 Plus
Dana\GF19807-PA 244 GF19807-PA 72..235 69..225 192 31.5 Plus
Dana\GF19809-PA 280 GF19809-PA 83..273 52..233 177 34.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23352-PA 244 GG23352-PA 1..244 1..246 1086 84.6 Plus
Dere\GG10647-PA 303 GG10647-PA 145..288 93..231 263 49.3 Plus
Dere\GG11285-PA 232 GG11285-PA 49..226 52..231 219 39.6 Plus
Dere\GG10650-PA 256 GG10650-PA 84..245 69..223 195 34.3 Plus
Dere\GG25129-PA 248 GG25129-PA 76..248 69..234 180 35.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20816-PA 242 GH20816-PA 20..226 19..231 412 45.1 Plus
Dgri\GH19654-PA 242 GH19654-PA 20..226 19..231 412 45.1 Plus
Dgri\GH21087-PA 300 GH21087-PA 123..282 72..228 209 40 Plus
Dgri\GH20817-PA 240 GH20817-PA 92..233 93..239 200 41.3 Plus
Dgri\GH18815-PA 169 GH18815-PA 24..165 91..235 197 38.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8701-PA 246 CG8701-PA 1..246 1..246 1395 100 Plus
CG2127-PB 289 CG2127-PB 58..274 36..231 338 42.5 Plus
CG2127-PA 305 CG2127-PA 74..290 36..231 338 42.5 Plus
CG33340-PA 229 CG33340-PA 46..223 52..231 295 41.2 Plus
CG4691-PA 262 CG4691-PA 84..259 64..231 272 35.7 Plus
boly-PA 255 CG30362-PA 78..244 64..223 219 31.6 Plus
CG12860-PA 316 CG12860-PA 143..311 77..239 216 32.6 Plus
hubl-PB 291 CG30364-PB 73..279 34..235 215 32.6 Plus
hubl-PA 291 CG30364-PA 73..279 34..235 215 32.6 Plus
swif-PB 284 CG30366-PB 97..281 59..234 213 33.3 Plus
swif-PA 284 CG30366-PA 97..281 59..234 213 33.3 Plus
CG12861-PA 239 CG12861-PA 74..230 80..225 203 36.7 Plus
cola-PA 259 CG30363-PA 86..219 83..216 162 31.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20909-PA 248 GI20909-PA 1..232 1..231 440 44.9 Plus
Dmoj\GI10075-PA 236 GI10075-PA 89..228 91..231 208 40.6 Plus
Dmoj\GI20912-PA 250 GI20912-PA 95..235 93..231 200 39.1 Plus
Dmoj\GI20915-PA 272 GI20915-PA 95..263 69..225 194 36.6 Plus
Dmoj\GI18687-PA 297 GI18687-PA 121..278 74..227 191 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11217-PA 243 GL11217-PA 1..229 1..233 565 51.5 Plus
Dper\GL10866-PA 259 GL10866-PA 101..244 93..231 213 41 Plus
Dper\GL10869-PA 261 GL10869-PA 85..252 69..225 190 38.1 Plus
Dper\GL21858-PA 176 GL21858-PA 33..169 91..230 165 41.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21267-PA 243 GA21267-PA 1..229 1..233 565 51.5 Plus
Dpse\GA15259-PA 259 GA15259-PA 101..244 93..231 213 41 Plus
Dpse\GA15789-PA 261 GA15789-PA 85..252 69..225 192 38.1 Plus
Dpse\GA26429-PA 176 GA26429-PA 33..169 91..230 168 42.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21027-PA 246 GM21027-PA 1..246 1..246 1148 94.7 Plus
Dsec\GM20692-PA 305 GM20692-PA 145..290 93..231 290 49 Plus
Dsec\GM26593-PA 232 GM26593-PA 49..226 52..231 234 41.2 Plus
Dsec\GM15754-PA 262 GM15754-PA 89..262 69..234 193 34.1 Plus
Dsec\GM20695-PA 252 GM20695-PA 83..241 69..223 175 31.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15275-PA 305 GD15275-PA 145..290 93..231 286 49 Plus
Dsim\GD21095-PA 232 GD21095-PA 49..226 52..231 234 41.2 Plus
Dsim\GD23976-PA 262 GD23976-PA 89..262 69..234 193 34.1 Plus
Dsim\GD15278-PA 252 GD15278-PA 83..241 69..223 172 31.9 Plus
Dsim\GD15280-PA 285 GD15280-PA 125..281 86..234 165 36.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20639-PA 249 GJ20639-PA 1..233 1..231 438 44.3 Plus
Dvir\GJ23810-PA 238 GJ23810-PA 12..230 18..231 240 34.2 Plus
Dvir\GJ20641-PA 249 GJ20641-PA 94..234 93..231 211 38.3 Plus
Dvir\GJ20646-PA 263 GJ20646-PA 103..233 93..227 195 37.9 Plus
Dvir\GJ21704-PA 303 GJ21704-PA 132..284 78..227 176 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15752-PA 216 GK15752-PA 3..214 29..242 589 59.3 Plus
Dwil\GK10491-PA 189 GK10491-PA 1..158 1..160 419 55.9 Plus
Dwil\GK23104-PA 244 GK23104-PA 3..131 29..160 406 62.9 Plus
Dwil\GK24059-PA 158 GK24059-PA 3..127 29..160 377 61.4 Plus
Dwil\GK14336-PA 247 GK14336-PA 3..115 29..142 373 64.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19192-PA 245 GE19192-PA 1..243 1..243 1135 88.9 Plus
Dyak\GE23064-PA 307 GE23064-PA 133..292 79..231 288 45.6 Plus
Dyak\GE23478-PA 232 GE23478-PA 49..226 52..231 221 40.1 Plus
Dyak\GE19047-PA 239 GE19047-PA 66..239 69..234 211 35.8 Plus
Dyak\GE23091-PA 256 GE23091-PA 84..245 69..223 186 33.1 Plus

GH07855.hyp Sequence

Translation from 175 to 915

> GH07855.hyp
MSMWRSIGTKTQNRVIPSFASVVCHRAFAKDHNPSPKCSDSSGKGCGNFT
ACGDPRFAKKPPPKKEDGFQFHHLVKQPPECCTDPCAERFPPYDQCYYKI
SDKATRKYQVTWVECPPIKIKPKKICCYEAGIRPPIPRRKRKKFVTSAEC
PTNVECPTEGGPCPRIKMPGCKAVDSVSCHVVRRKTDCVKVKAPYPSFSE
CSRSRLRKPRGVECNCLDVPSSCDLIRELKKFEGNPRKPNCGGSRA*

GH07855.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8701-PA 246 CG8701-PA 1..246 1..246 1395 100 Plus
CG2127-PB 289 CG2127-PB 58..274 36..231 338 42.5 Plus
CG2127-PA 305 CG2127-PA 74..290 36..231 338 42.5 Plus
CG33340-PA 229 CG33340-PA 46..223 52..231 295 41.2 Plus
CG4691-PA 262 CG4691-PA 84..259 64..231 272 35.7 Plus