Clone GH07879 Report

Search the DGRC for GH07879

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:78
Well:79
Vector:pOT2
Associated Gene/TranscriptCG6332-RA
Protein status:GH07879.pep: gold
Preliminary Size:1380
Sequenced Size:1299

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6332 2001-01-01 Release 2 assignment
CG6332 2002-03-19 Blastp of sequenced clone
CG6332 2003-01-01 Sim4 clustering to Release 3
CG6332 2008-04-29 Release 5.5 accounting
CG6332 2008-08-15 Release 5.9 accounting
CG6332 2008-12-18 5.12 accounting

Clone Sequence Records

GH07879.complete Sequence

1299 bp (1299 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094685

> GH07879.complete
TTCAGATAATCGTAGATGTTTTTTATCATAAGCGAATAAAAAAGTTAGCA
TTAATTGGTTTAAAGTAGTGCGTCAAAATTCGGAAATCCACAGAATGACC
ATCCAAGGACTGAAGTGTGACCTCAGCCCGACGGTGACCACTTGTCTGCA
GCTGAAGGACTGCGTCCGTCCGGACTGCTGTCCCATCCGGGACCCCATTC
CCTACGATGCCGAGTGCTTCGTTAGGGACATTGGCCAGGAGCTGGACAAA
CTGACGCGCCGACACGAGCGCATGTTCGTCAAGCGGCGGCGTCTGATGGA
AATGGCCATACCCAGGCGACGCACCTGCCGCTTTGTGCCGAAATGCGCCT
GCTCATTTCCCAAGTCCATCGAGATGGTGCGACCATGTGACGCCCAGAAT
CACACACGCACCGAGCAACTAGCTCTGCCCACGGTCCGTCGATTGCTTCA
CAGGCGGCGAACGGCCATTCTGGCGGGCGACTCAATTGGGGAGTCCATAC
TGAACAGATGGCTTCGCTACAGCTATCTATCGCTGTACAGTCGTCTCACG
AATATCCAGCCGTTGGTTAAGCCGAAGAAAAAGAAGAAGAAGACGGAGAA
GCAGCTGGCTAAGCACGAGAAGTACATCGAAAAGTTGGCGAAACCAAAGA
AAGCACCAAAGGTCCCGAAACCGGATCGTGGAGCTGGGGAGTTCGATCCC
GTGCGTCTCAATCAGCTGGCCAGTCCCAAGGCCTATTTGGAGGAGATCAA
ACCCAAGTGGGAGCTGACCTCCCAGATGAAGGACTACAAGGCGACCAAGC
GGATCAAGCAAATATCGCAGCCCGTCGTGCGCGATAATGTCCACATCAAC
GAGAATCCGGAGAAGGTCTCGCCCAATGCCCTTCGCTACAAGCCGAGTGC
CCGCATCAAGGAGATGTCCGAGCCACTTACCACGCGCGATGCCAACCAAG
GACTGGCGGATGTCAAGGAGAATCCATTCGGTATCGCGCCAAACGCGCTC
AAATACAAGGCGAGCACGCGGATCAAGGAGCTGGCGGAGCCCAAGGAGTT
CGAGAACACGCATATCCGGGAGAATCCGTTTGCCATATCGCCGGCGGCTC
TGAAGGCCAAAGCCTCGCCACGCCTCATCGAGTTGGCCAAGCCCAAGGGT
GGATAATAATTGGAGACGGACGTGGACTGTGCGTCTGGATAATCATTACC
GTCCTTATTGGTGTTCTAAGTTTTTCATTTCGGCTACATTTGGTATCGAC
TTTTCTAATAAATTTGTTTTTGGTTTTTTAAAAAAAAAAAAAAAAAAAA

GH07879.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6332-RA 1358 CG6332-RA 73..1357 1..1285 6425 100 Plus
CG6332.a 2052 CG6332.a 774..2052 1..1279 6395 100 Plus
CG6332-RB 1382 CG6332-RB 38..930 1..893 4465 100 Plus
CG6332-RB 1382 CG6332-RB 997..1382 894..1279 1930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17838485..17839058 1..574 2810 99.3 Plus
chr3R 27901430 chr3R 17839578..17839963 894..1279 1900 99.5 Plus
chr3R 27901430 chr3R 17839291..17839511 673..893 1090 99.5 Plus
chr3R 27901430 chr3R 17839131..17839231 574..674 505 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:37:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22014734..22015307 1..574 2870 100 Plus
3R 32079331 3R 22015827..22016218 894..1285 1960 100 Plus
3R 32079331 3R 22015540..22015760 673..893 1105 100 Plus
3R 32079331 3R 22015380..22015480 574..674 505 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21755565..21756138 1..574 2870 100 Plus
3R 31820162 3R 21756658..21757049 894..1285 1960 100 Plus
3R 31820162 3R 21756371..21756591 673..893 1105 100 Plus
3R 31820162 3R 21756211..21756311 574..674 505 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:35:49 has no hits.

GH07879.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:36:45 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17838485..17839058 1..574 99 == Plus
chr3R 17839162..17839230 605..673 100 -> Plus
chr3R 17839292..17839511 674..893 99 -> Plus
chr3R 17839578..17839963 894..1279 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:25:10 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 1..1062 95..1156 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:37 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 1..1062 95..1156 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:10 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 1..1062 95..1156 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:49 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 1..1062 95..1156 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:34:20 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 1..1062 95..1156 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:40 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 38..1316 1..1279 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:37 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 38..1316 1..1279 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:10 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 38..1316 1..1279 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:49 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 38..1316 1..1279 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:34:20 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
CG6332-RA 38..1316 1..1279 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:36:45 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22015380..22015479 574..673 100 -> Plus
3R 22015541..22015760 674..893 100 -> Plus
3R 22015827..22016212 894..1279 100   Plus
3R 22014734..22015306 1..573 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:36:45 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22015380..22015479 574..673 100 -> Plus
3R 22015541..22015760 674..893 100 -> Plus
3R 22015827..22016212 894..1279 100   Plus
3R 22014734..22015306 1..573 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:36:45 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22015380..22015479 574..673 100 -> Plus
3R 22015541..22015760 674..893 100 -> Plus
3R 22015827..22016212 894..1279 100   Plus
3R 22014734..22015306 1..573 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:10 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17840456..17841028 1..573 100 -> Plus
arm_3R 17841102..17841201 574..673 100 -> Plus
arm_3R 17841263..17841482 674..893 100 -> Plus
arm_3R 17841549..17841934 894..1279 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:34 Download gff for GH07879.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21755565..21756137 1..573 100 -> Plus
3R 21756211..21756310 574..673 100 -> Plus
3R 21756372..21756591 674..893 100 -> Plus
3R 21756658..21757043 894..1279 100   Plus

GH07879.pep Sequence

Translation from 94 to 1155

> GH07879.pep
MTIQGLKCDLSPTVTTCLQLKDCVRPDCCPIRDPIPYDAECFVRDIGQEL
DKLTRRHERMFVKRRRLMEMAIPRRRTCRFVPKCACSFPKSIEMVRPCDA
QNHTRTEQLALPTVRRLLHRRRTAILAGDSIGESILNRWLRYSYLSLYSR
LTNIQPLVKPKKKKKKTEKQLAKHEKYIEKLAKPKKAPKVPKPDRGAGEF
DPVRLNQLASPKAYLEEIKPKWELTSQMKDYKATKRIKQISQPVVRDNVH
INENPEKVSPNALRYKPSARIKEMSEPLTTRDANQGLADVKENPFGIAPN
ALKYKASTRIKELAEPKEFENTHIRENPFAISPAALKAKASPRLIELAKP
KGG*

GH07879.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18061-PA 353 GF18061-PA 1..353 1..353 1351 81.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11098-PA 353 GG11098-PA 1..353 1..353 1679 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20942-PA 353 GH20942-PA 1..352 1..353 1230 69.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6332-PA 353 CG6332-PA 1..353 1..353 1848 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10725-PA 352 GI10725-PA 1..352 1..353 1111 66 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23808-PA 351 GL23808-PA 2..351 3..353 1174 69.8 Plus
Dper\GL23726-PA 208 GL23726-PA 41..200 164..351 150 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19518-PA 351 GA19518-PA 2..351 3..353 1171 69.8 Plus
Dpse\GA26718-PA 294 GA26718-PA 111..286 145..351 156 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26392-PA 353 GM26392-PA 1..353 1..353 1847 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20913-PA 353 GD20913-PA 1..353 1..353 1846 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23139-PA 352 GJ23139-PA 1..352 1..353 1231 68.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14237-PA 344 GK14237-PA 3..344 11..353 1181 67.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10260-PA 353 GE10260-PA 1..353 1..353 1832 98 Plus

GH07879.hyp Sequence

Translation from 94 to 1155

> GH07879.hyp
MTIQGLKCDLSPTVTTCLQLKDCVRPDCCPIRDPIPYDAECFVRDIGQEL
DKLTRRHERMFVKRRRLMEMAIPRRRTCRFVPKCACSFPKSIEMVRPCDA
QNHTRTEQLALPTVRRLLHRRRTAILAGDSIGESILNRWLRYSYLSLYSR
LTNIQPLVKPKKKKKKTEKQLAKHEKYIEKLAKPKKAPKVPKPDRGAGEF
DPVRLNQLASPKAYLEEIKPKWELTSQMKDYKATKRIKQISQPVVRDNVH
INENPEKVSPNALRYKPSARIKEMSEPLTTRDANQGLADVKENPFGIAPN
ALKYKASTRIKELAEPKEFENTHIRENPFAISPAALKAKASPRLIELAKP
KGG*

GH07879.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG6332-PA 353 CG6332-PA 1..353 1..353 1848 100 Plus