Clone GH07914 Report

Search the DGRC for GH07914

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:79
Well:14
Vector:pOT2
Associated Gene/TranscriptCG33307-RA
Protein status:GH07914.pep: gold
Preliminary Size:789
Sequenced Size:619

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9008 2001-01-01 Release 2 assignment
CG8969 2001-01-01 Release 2 assignment
CG8978 2001-01-01 Release 2 assignment
CG8987 2001-01-01 Release 2 assignment
CG16887 2001-01-01 Release 2 assignment
CG16888 2001-01-01 Release 2 assignment
CG16889 2001-01-01 Release 2 assignment
CG16890 2001-01-01 Release 2 assignment
CG33307 2001-07-04 Blastp of sequenced clone
CG33307 2008-04-29 Release 5.5 accounting
CG33307 2008-08-15 Release 5.9 accounting
CG33307 2008-12-18 5.12 accounting

Clone Sequence Records

GH07914.complete Sequence

619 bp (619 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047567

> GH07914.complete
AGGCTTTCGATTTTTTATCAATAAGACGCGATGCTGAAATATATTCCTTT
ACTTTTAGTAGCCCAGCTATTAATAGTGGCTGCCAAGCCCACAAATCCAC
AACTCCTAAACTCCGATGATCCAGTGCAAAGGGAGTTGGAGAGACAGGCC
AAGGAGGAGACAGTCCACCTGCTGAACTCGTTGTTCCGATCACAAATCGC
CTATTTCTCCGAGGTGAAGGCCGCTCTGAATCCCCAGACCAAGCGATTCC
AAGATATCAGTCTTTATATAACGCGCCTGAGCCAAGCCATTGATGAGCAG
GAACTGGACCGAAAGGATGAGCTGTGGCAGAATATCTTCGAAGAGTTCAA
GGACTCTCCACTGCTGATTAATCGGCAATCCGAGACAGGACTCACCGACT
TGCAATATAAGACACTCCTGACCGGCCAGAAGCTGCAGAATATATCCACC
AAGTTCGTGAGCGATGTGGCCGATTACTTCTGGGAAATGGCCAAGATTAG
TGGCAAAGTCGTTGGCAATGGGATAGCGAGCCAGAACGAATAGTAAATCT
CAATAAACTATAAATGTATCGAACGAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

GH07914.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG33307-RA 829 CG33307-RA 129..705 1..577 2885 100 Plus
CG33307.a 670 CG33307.a 23..599 1..577 2885 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13839836..13840117 345..64 1410 100 Minus
chr2L 23010047 chr2L 13839546..13839777 575..344 1160 100 Minus
chr2L 23010047 chr2L 13840184..13840249 66..1 330 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:37:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13841096..13841377 345..64 1410 100 Minus
2L 23513712 2L 13840804..13841037 577..344 1170 100 Minus
2L 23513712 2L 13841444..13841509 66..1 330 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13841096..13841377 345..64 1410 100 Minus
2L 23513712 2L 13840804..13841037 577..344 1170 100 Minus
2L 23513712 2L 13841444..13841509 66..1 330 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:39:19 has no hits.

GH07914.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:40:18 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13839546..13839775 346..575 100 <- Minus
chr2L 13839836..13840114 67..345 100 <- Minus
chr2L 13840184..13840249 1..66 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:25:23 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..513 31..543 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:29:09 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..513 31..543 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:42 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..513 31..543 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:34 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..513 31..543 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:17 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..513 31..543 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:29:29 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..575 1..575 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:29:09 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..575 1..575 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:42 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 12..586 1..575 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:34 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 1..575 1..575 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:17 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
CG33307-RA 12..586 1..575 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:18 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13840806..13841035 346..575 100 <- Minus
2L 13841096..13841374 67..345 100 <- Minus
2L 13841444..13841509 1..66 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:18 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13840806..13841035 346..575 100 <- Minus
2L 13841096..13841374 67..345 100 <- Minus
2L 13841444..13841509 1..66 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:18 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13840806..13841035 346..575 100 <- Minus
2L 13841096..13841374 67..345 100 <- Minus
2L 13841444..13841509 1..66 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:42 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13840806..13841035 346..575 100 <- Minus
arm_2L 13841096..13841374 67..345 100 <- Minus
arm_2L 13841444..13841509 1..66 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:40:33 Download gff for GH07914.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13840806..13841035 346..575 100 <- Minus
2L 13841096..13841374 67..345 100 <- Minus
2L 13841444..13841509 1..66 100   Minus

GH07914.pep Sequence

Translation from 30 to 542

> GH07914.pep
MLKYIPLLLVAQLLIVAAKPTNPQLLNSDDPVQRELERQAKEETVHLLNS
LFRSQIAYFSEVKAALNPQTKRFQDISLYITRLSQAIDEQELDRKDELWQ
NIFEEFKDSPLLINRQSETGLTDLQYKTLLTGQKLQNISTKFVSDVADYF
WEMAKISGKVVGNGIASQNE*

GH07914.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15616-PA 175 GF15616-PA 2..166 1..165 524 59.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10177-PA 170 GG10177-PA 1..170 1..170 823 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10613-PA 175 GH10613-PA 2..167 1..165 410 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG33307-PB 170 CG33307-PB 1..170 1..170 851 100 Plus
CG33307-PA 170 CG33307-PA 1..170 1..170 851 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17404-PA 176 GI17404-PA 2..162 1..165 430 52.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21077-PA 83 GL21077-PA 2..82 1..105 168 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29062-PA 176 GA29062-PA 2..166 1..165 506 61.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15052-PA 170 GM15052-PA 1..170 1..170 845 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22034-PA 170 GD22034-PA 1..170 1..170 798 94.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18084-PA 163 GJ18084-PA 1..157 10..165 426 54.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15118-PA 180 GK15118-PA 1..163 1..165 497 58.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11378-PA 170 GE11378-PA 1..170 1..170 753 91.2 Plus

GH07914.hyp Sequence

Translation from 30 to 542

> GH07914.hyp
MLKYIPLLLVAQLLIVAAKPTNPQLLNSDDPVQRELERQAKEETVHLLNS
LFRSQIAYFSEVKAALNPQTKRFQDISLYITRLSQAIDEQELDRKDELWQ
NIFEEFKDSPLLINRQSETGLTDLQYKTLLTGQKLQNISTKFVSDVADYF
WEMAKISGKVVGNGIASQNE*

GH07914.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG33307-PB 170 CG33307-PB 1..170 1..170 851 100 Plus
CG33307-PA 170 CG33307-PA 1..170 1..170 851 100 Plus