Clone GH07966 Report

Search the DGRC for GH07966

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:79
Well:66
Vector:pOT2
Associated Gene/TranscriptCG2652-RA
Protein status:GH07966.pep: gold
Preliminary Size:1054
Sequenced Size:969

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2652 2001-01-01 Release 2 assignment
CG2652 2002-06-12 Blastp of sequenced clone
CG2652 2003-01-01 Sim4 clustering to Release 3
CG2652 2008-04-29 Release 5.5 accounting
CG2652 2008-08-15 Release 5.9 accounting
CG2652 2008-12-18 5.12 accounting

Clone Sequence Records

GH07966.complete Sequence

969 bp (969 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122098

> GH07966.complete
ATCACACCAAGCAAACAAGTTAAAGTTGCCTTCAAATTTTCGTAGAAAAA
TTTTTAGTTAAACATAAATTGAAATTAGTTTTTTTTTTTTTTTTTTTTTT
TTTGAATCGTGATGAGCTACACAAATCTCCTGCGCCATCAGAATGTGGTC
GATGACTGCCAGCGGGTGAGCTGCAACCGCACTCCGCCGATCACTGTCAC
CGGGCGCTGTGTGATCAGTCGGGACATCGTGATCGGCTGCCGCATGGAAC
AGTGCGATCCGGACATGCCCTACATGCTGGAGCCGACGTGGGGCGTCTAC
CTGCGCCCAGGTCGCGATGGCGGCGACCTGTCGCGGTTCGTGCGGCGCGT
CACCTTCAAGATGTCGCCGCGCCTGCCGCTGCGACTGCACGTGGCGGACA
GCGCTCCGTTTGAGATTGGCGAGGTACTGGGCAGCGACTTTCCCGTGGAG
GTGCAGGTGCAGTATATGGATGCCCGCATGTCGGCCACCTCGTACATCTT
CCGGCCGCGCGTGGTGCGCGAGGGTCACGCCGGTATTTGCGAGGAGATGC
TCGACAAGATGATATTCGTCAATCCCTCGCCCATGATGAGACAGAATCTA
ACGCCCGTGCTTGTGCCCAGTGCAAATGGTGCGCCCGGGGACAGGACATC
GCCCCAGTTTGCAATGGAGTCCGCCATGCCGGAGACACCGGGTGAGCGAA
AGGAACAGGACCGGGATCGGGAGCAGGTGGGCGATGTGGCGCGACCCTCG
CAGCCGCCGGCAAAGCAGCCCAAGAAGCGTCTAAGTGTGGGCATACCCCA
TCCCATCGGTCATCAGTAGTCGTGTATAGATACATTGGGCTCTATGAAAG
GAACAACTGAGAATGTTTGTTGTCCTGGCATGTGCAGTTACTGGATTGGC
ATTGGATACGTTTAAATTACTAAATAAATTATGAATTTCATTTACTTCTA
AAAAAAAAAAAAAAAAAAA

GH07966.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG2652-RA 946 CG2652-RA 1..946 1..949 4675 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2575803..2576748 949..1 4665 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:37:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2681985..2682932 951..1 4675 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2690083..2691030 951..1 4685 99.6 Minus
Blast to na_te.dros performed 2019-03-15 22:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 548..617 748..821 134 70.3 Plus
aurora-element 4263 aurora-element DMAURA 4263bp Derived from AB022762 (d1268008) (Rel. 59, Last updated, Version 1). 328..384 748..807 112 70 Plus

GH07966.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:12:10 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2575803..2576748 1..949 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:25:55 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..708 112..819 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:13 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..708 112..819 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:11:12 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..708 112..819 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:11 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..708 112..819 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:14:24 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..708 112..819 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:57 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..946 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:13 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..946 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:11:12 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..946 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:11 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..946 1..949 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:14:24 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
CG2652-RA 1..946 1..949 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:12:10 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
X 2681987..2682932 1..949 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:12:10 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
X 2681987..2682932 1..949 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:12:10 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
X 2681987..2682932 1..949 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:11:12 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2576020..2576965 1..949 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:03 Download gff for GH07966.complete
Subject Subject Range Query Range Percent Splice Strand
X 2690085..2691030 1..949 99   Minus

GH07966.hyp Sequence

Translation from 111 to 818

> GH07966.hyp
MSYTNLLRHQNVVDDCQRVSCNRTPPITVTGRCVISRDIVIGCRMEQCDP
DMPYMLEPTWGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPF
EIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGICEEMLDKM
IFVNPSPMMRQNLTPVLVPSANGAPGDRTSPQFAMESAMPETPGERKEQD
RDREQVGDVARPSQPPAKQPKKRLSVGIPHPIGHQ*

GH07966.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG2652-PA 235 CG2652-PA 1..235 1..235 1253 100 Plus

GH07966.pep Sequence

Translation from 111 to 818

> GH07966.pep
MSYTNLLRHQNVVDDCQRVSCNRTPPITVTGRCVISRDIVIGCRMEQCDP
DMPYMLEPTWGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPF
EIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGICEEMLDKM
IFVNPSPMMRQNLTPVLVPSANGAPGDRTSPQFAMESAMPETPGERKEQD
RDREQVGDVARPSQPPAKQPKKRLSVGIPHPIGHQ*

GH07966.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21373-PA 280 GF21373-PA 1..189 1..189 741 72.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18616-PA 234 GG18616-PA 1..234 1..235 1013 84.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24105-PA 239 GH24105-PA 1..219 1..196 379 39.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG2652-PA 235 CG2652-PA 1..235 1..235 1253 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14375-PA 251 GI14375-PA 1..177 1..164 379 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26736-PA 213 GL26736-PA 2..180 1..180 510 56.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15410-PA 213 GA15410-PA 2..210 1..222 516 50.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18866-PA 233 GM18866-PA 1..231 1..231 1132 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24606-PA 231 GD24606-PA 1..229 1..231 1108 90.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19414-PA 261 GJ19414-PA 1..187 1..170 398 45.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10266-PA 233 GK10266-PA 1..179 1..164 443 51.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16931-PA 247 GE16931-PA 1..237 1..235 1004 82.8 Plus