Clone GH07967 Report

Search the DGRC for GH07967

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:79
Well:67
Vector:pOT2
Associated Gene/TranscriptCG9338-RA
Protein status:GH07967.pep: gold
Preliminary Size:791
Sequenced Size:697

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9338 2001-01-01 Release 2 assignment
CG9338 2002-05-28 Blastp of sequenced clone
CG9338 2003-01-01 Sim4 clustering to Release 3
CG9338 2008-04-29 Release 5.5 accounting
CG9338 2008-08-15 Release 5.9 accounting
CG9338 2008-12-18 5.12 accounting

Clone Sequence Records

GH07967.complete Sequence

697 bp (697 high quality bases) assembled on 2002-05-28

GenBank Submission: AY119487

> GH07967.complete
CCAACTGCCGTGCAGTCAAGGTTTGCTTTAAGTAATTTTCCAAAAAAGTA
GTTTCAATCCCTGAAAATGGTGTCGAGTGTAAAAATGATCTTGGCTCTCA
CCGTCTTGGCCACCGTAGCCTGCACTGGCTACGCCATCAAGTGCTATCAG
TGCGATTCCTTGACTAATTCCGAGTGTGGAAAGGACATCAAGTCAGACAG
TAGCCTCGTTTTGGATTGCACCAAGATGGCTCCACCTCGATTCCTCCAGA
ACTTCTTCCCGGTTCGCAACGCCACCGGTTGCATGAAGCAGACCATCGAC
ATTCCCGGTAACCCGCAAATCGTGAGGTCCTGCTACTTTGGCAACATCGC
CGACACGAAGGTTGGATGCCAGACCGATCCCAGCCTGACGATCAACAAGT
TGCTGAGCTGCGAGGTTTGCACCGAGGACGAGTGCAACGGAACCTCCTCC
CTGGCCCCCATCGCCGGAGTCATACTCCTGTTCTTTGGCCTGGCCCGTCT
GCTAGCCTGAACGAGGAGCAGTTTGTAGTACCGCTGAGCTATCCCAAACA
TATCGAACTTGCTGTTGGGAAGCCAGACCCATGGAGCTGCTTTAGTCACC
TTTGAATCTCTTGTAATTGTTACACCCTTTTAAACTGTTTTCGCCCACAT
TAAATGTCGCTTTATTTATGTGAAGATAAAAAAAAAAAAAAAAAAAA

GH07967.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9338-RA 1101 CG9338-RA 96..773 1..678 3390 100 Plus
CG9336.b 582 CG9336.b 347..453 402..508 340 87.8 Plus
CG9336.c 646 CG9336.c 410..516 402..508 340 87.8 Plus
CG9336.b 582 CG9336.b 154..241 212..299 170 79.5 Plus
CG9336.c 646 CG9336.c 217..304 212..299 170 79.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20865470..20865845 302..677 1880 100 Plus
chr2L 23010047 chr2L 20863944..20864118 127..301 875 100 Plus
chr2L 23010047 chr2L 20863760..20863887 1..128 640 100 Plus
chr2L 23010047 chr2L 20859221..20859416 313..508 350 78.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:37:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20866936..20867312 302..678 1885 100 Plus
2L 23513712 2L 20865411..20865585 127..301 875 100 Plus
2L 23513712 2L 20865227..20865354 1..128 640 100 Plus
2L 23513712 2L 20860693..20860888 313..508 350 78.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20866936..20867312 302..678 1885 100 Plus
2L 23513712 2L 20865411..20865585 127..301 875 100 Plus
2L 23513712 2L 20865227..20865354 1..128 640 100 Plus
2L 23513712 2L 20860782..20860888 402..508 340 87.8 Plus
2L 23513712 2L 20859809..20859896 212..299 170 79.5 Plus
Blast to na_te.dros performed on 2019-03-16 23:55:52 has no hits.

GH07967.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:57:08 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20863945..20864118 128..301 100 -> Plus
chr2L 20865470..20865845 302..677 100   Plus
chr2L 20863760..20863886 1..127 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:25:58 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..444 67..510 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:37:10 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..444 67..510 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:55 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..444 67..510 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:47 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..444 67..510 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:04:08 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..444 67..510 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:09:33 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..677 1..677 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:37:10 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..677 1..677 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:55 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 13..689 1..677 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:47 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 1..677 1..677 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:04:08 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
CG9338-RA 13..689 1..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:57:08 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20865227..20865353 1..127 100 -> Plus
2L 20865412..20865585 128..301 100 -> Plus
2L 20866936..20867311 302..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:57:08 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20865227..20865353 1..127 100 -> Plus
2L 20865412..20865585 128..301 100 -> Plus
2L 20866936..20867311 302..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:57:08 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20865227..20865353 1..127 100 -> Plus
2L 20865412..20865585 128..301 100 -> Plus
2L 20866936..20867311 302..677 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:55 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20865227..20865353 1..127 100 -> Plus
arm_2L 20865412..20865585 128..301 100 -> Plus
arm_2L 20866936..20867311 302..677 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:01:21 Download gff for GH07967.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20866936..20867311 302..677 100   Plus
2L 20865227..20865353 1..127 100 -> Plus
2L 20865412..20865585 128..301 100 -> Plus

GH07967.hyp Sequence

Translation from 66 to 509

> GH07967.hyp
MVSSVKMILALTVLATVACTGYAIKCYQCDSLTNSECGKDIKSDSSLVLD
CTKMAPPRFLQNFFPVRNATGCMKQTIDIPGNPQIVRSCYFGNIADTKVG
CQTDPSLTINKLLSCEVCTEDECNGTSSLAPIAGVILLFFGLARLLA*

GH07967.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9338-PB 147 CG9338-PB 1..147 1..147 770 100 Plus
CG9338-PA 147 CG9338-PA 1..147 1..147 770 100 Plus
CG9336-PA 148 CG9336-PA 1..148 1..147 524 62.8 Plus
CG9336-PB 115 CG9336-PB 3..115 36..147 415 64.6 Plus
CG31675-PA 148 CG31675-PA 5..148 8..146 258 38.2 Plus

GH07967.pep Sequence

Translation from 66 to 509

> GH07967.pep
MVSSVKMILALTVLATVACTGYAIKCYQCDSLTNSECGKDIKSDSSLVLD
CTKMAPPRFLQNFFPVRNATGCMKQTIDIPGNPQIVRSCYFGNIADTKVG
CQTDPSLTINKLLSCEVCTEDECNGTSSLAPIAGVILLFFGLARLLA*

GH07967.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20975-PA 148 GF20975-PA 1..148 1..147 511 61.5 Plus
Dana\GF20986-PA 148 GF20986-PA 1..148 1..147 499 64.9 Plus
Dana\GF20997-PA 152 GF20997-PA 3..133 6..135 269 38.2 Plus
Dana\GF21008-PA 145 GF21008-PA 18..139 20..142 144 31.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21264-PA 147 GG21264-PA 1..147 1..147 705 91.2 Plus
Dere\GG21263-PA 148 GG21263-PA 1..148 1..147 508 60.8 Plus
Dere\GG21268-PA 147 GG21268-PA 1..147 7..147 479 63.5 Plus
Dere\GG21267-PA 152 GG21267-PA 1..152 1..147 467 61.9 Plus
Dere\GG10978-PA 159 GG10978-PA 1..140 1..133 454 62.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10592-PA 148 GH10592-PA 1..148 1..147 565 67.6 Plus
Dgri\GH10591-PA 148 GH10591-PA 1..148 1..147 516 60.8 Plus
Dgri\GH10593-PA 153 GH10593-PA 18..126 22..129 231 39.4 Plus
Dgri\GH10594-PA 147 GH10594-PA 22..144 24..142 149 32.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9338-PB 147 CG9338-PB 1..147 1..147 770 100 Plus
CG9338-PA 147 CG9338-PA 1..147 1..147 770 100 Plus
CG9336-PA 148 CG9336-PA 1..148 1..147 524 62.8 Plus
CG9336-PB 115 CG9336-PB 3..115 36..147 415 64.6 Plus
CG31675-PA 148 CG31675-PA 5..148 8..146 258 38.2 Plus
CG14401-PA 146 CG14401-PA 7..145 8..147 187 35.4 Plus
CG14401-PC 150 CG14401-PC 7..149 8..147 176 34.5 Plus
CG14401-PB 198 CG14401-PB 74..197 23..147 170 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23209-PA 148 GI23209-PA 1..148 1..147 484 64.2 Plus
Dmoj\GI23198-PA 148 GI23198-PA 1..148 1..147 476 55.4 Plus
Dmoj\GI23220-PA 153 GI23220-PA 20..125 24..128 247 40.6 Plus
Dmoj\GI23230-PA 148 GI23230-PA 19..146 20..139 164 34.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18529-PA 148 GL18529-PA 1..148 1..147 591 72.3 Plus
Dper\GL25347-PA 148 GL25347-PA 1..148 1..147 519 62.2 Plus
Dper\GL18528-PA 115 GL18528-PA 3..115 36..147 414 63.7 Plus
Dper\GL18530-PA 150 GL18530-PA 17..129 20..135 250 41.9 Plus
Dper\GL18531-PA 150 GL18531-PA 1..149 5..147 155 27.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25674-PA 148 GA25674-PA 1..148 1..147 591 72.3 Plus
Dpse\GA21711-PA 146 GA21711-PA 20..146 22..147 476 65.4 Plus
Dpse\GA16386-PA 150 GA16386-PA 17..129 20..135 250 41.9 Plus
Dpse\GA25675-PA 150 GA25675-PA 1..149 5..147 155 27.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23382-PA 141 GM23382-PA 1..141 7..147 702 94.3 Plus
Dsec\GM23380-PA 148 GM23380-PA 1..148 1..147 487 59.5 Plus
Dsec\GM23383-PA 148 GM23383-PA 3..125 6..127 258 39.8 Plus
Dsec\GM23384-PA 146 GM23384-PA 7..127 8..130 150 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24291-PA 245 GD24291-PA 112..245 14..147 665 92.5 Plus
Dsim\GD24290-PA 148 GD24290-PA 1..148 1..147 523 62.8 Plus
Dsim\GD24292-PA 148 GD24292-PA 3..125 6..127 258 39.8 Plus
Dsim\GD24293-PA 146 GD24293-PA 4..127 5..130 149 32.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23708-PA 148 GJ23708-PA 1..148 1..147 523 66.2 Plus
Dvir\GJ23697-PA 148 GJ23697-PA 1..148 1..147 517 62.2 Plus
Dvir\GJ23718-PA 265 GJ23718-PA 1..125 5..128 254 37.6 Plus
Dvir\GJ23718-PA 265 GJ23718-PA 142..253 26..137 147 30.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15443-PA 148 GK15443-PA 1..148 1..147 562 69.6 Plus
Dwil\GK15444-PA 148 GK15444-PA 1..148 1..147 509 64.9 Plus
Dwil\GK15441-PA 149 GK15441-PA 1..149 1..147 472 57.7 Plus
Dwil\GK15445-PA 125 GK15445-PA 18..125 20..126 244 42.6 Plus
Dwil\GK15446-PA 151 GK15446-PA 6..133 7..128 183 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12886-PA 147 GE12886-PA 1..147 1..147 730 94.6 Plus
Dyak\GE12885-PA 148 GE12885-PA 1..148 1..147 520 62.2 Plus
Dyak\GE12887-PA 148 GE12887-PA 3..148 6..146 262 38.4 Plus
Dyak\GE12888-PA 147 GE12888-PA 9..129 10..132 157 33.3 Plus