Clone GH08125 Report

Search the DGRC for GH08125

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:81
Well:25
Vector:pOT2
Associated Gene/TranscriptCG11808-RA
Protein status:GH08125.pep: gold
Preliminary Size:881
Sequenced Size:760

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11808 2001-01-01 Release 2 assignment
CG11808 2002-11-11 Blastp of sequenced clone
CG11808 2003-01-01 Sim4 clustering to Release 3
CG11808 2008-04-29 Release 5.5 accounting
CG11808 2008-08-15 Release 5.9 accounting
CG11808 2008-12-18 5.12 accounting

Clone Sequence Records

GH08125.complete Sequence

760 bp (760 high quality bases) assembled on 2002-11-11

GenBank Submission: AY069065

> GH08125.complete
AATAAATAATTAACTGCCGATAAAGGACACATTATGAGGGATCGCGACCG
CCGTGACAGAGATCGCGACAGAGAGAGGGATAGAGATCGGGACCGAGAAA
GAGACAGAGAGCGAGACCGCGACAGACGACACAGATCAAAGTCGCCCAGC
AGGAGCAGCCGGCAGGTTTCAAAACCGAAGAAGAAAAAGGCCAAGAAGTC
GAAAAAGTACTCGAGAAGGAGTCGCAGTAGCAGTCGCAGCACCTCGCGCA
GCTCCTCCAGCAGCAGGAGTAGTTCCCGCAGCACGCACAGCAAAAGCAGA
ACCAGGGATCATCACAAATCGCGGTCTATTTCGCAGAGGAAAACCAGGGG
TCCAAGTTCGGAAAGCAATTCCCGATCCGCAACCACACCCGCAGCTGCTC
CCGTGAAGGCCATCGATCTGTTCGACACCAAGGTGCAAAAGGCACTCGAG
ACTATAGACGAGGACACCTTCAAGCCGGAGTCATTTTTTAGCTCCAGGGA
TTCAAAGGAGACATCCGATAAGGTGATCATAGATCTGAACAATGAAACGG
TCACAGTCGCCAGCAAGCCAGCCACTGCAGTCCGAAACGAAGATGTAATA
TTCCATCCGAACTTCCTGGGCGACCCGGATATGAAGGCCGAGAAGTGGCT
GCGCAAGCTGTACAATTACCGCCAAAAGTACATGCAGGAGTAGTCGAGTT
TAGACTCTGTATTTAAGAAACAATAAACCTATGTCTAGAATAAAAAAAAA
AAAAAAAAAA

GH08125.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11808-RA 842 CG11808-RA 74..815 1..742 3710 100 Plus
mRpL41-RA 591 mRpL41-RA 543..591 742..694 245 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11103477..11104088 1..612 3060 100 Plus
chr2R 21145070 chr2R 11104152..11104280 613..741 645 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:37:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15216267..15216878 1..612 3060 100 Plus
2R 25286936 2R 15216942..15217071 613..742 650 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15217466..15218077 1..612 3060 100 Plus
2R 25260384 2R 15218141..15218270 613..742 650 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:42:50 has no hits.

GH08125.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:43:37 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11103477..11104088 1..612 100 -> Plus
chr2R 11104152..11104280 613..741 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:26:26 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 1..660 34..693 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:06:43 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 1..660 34..693 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:54 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 1..660 34..693 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:56:33 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 1..660 34..693 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:18:05 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 1..660 34..693 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:26:28 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 59..799 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:06:43 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 57..797 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:54 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 61..801 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:56:34 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 59..799 1..741 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:18:05 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11808-RA 61..801 1..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:37 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15216267..15216878 1..612 100 -> Plus
2R 15216942..15217070 613..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:37 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15216267..15216878 1..612 100 -> Plus
2R 15216942..15217070 613..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:37 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15216267..15216878 1..612 100 -> Plus
2R 15216942..15217070 613..741 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:54 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11103772..11104383 1..612 100 -> Plus
arm_2R 11104447..11104575 613..741 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:29:01 Download gff for GH08125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15217466..15218077 1..612 100 -> Plus
2R 15218141..15218269 613..741 100   Plus

GH08125.hyp Sequence

Translation from 33 to 692

> GH08125.hyp
MRDRDRRDRDRDRERDRDRDRERDRERDRDRRHRSKSPSRSSRQVSKPKK
KKAKKSKKYSRRSRSSSRSTSRSSSSSRSSSRSTHSKSRTRDHHKSRSIS
QRKTRGPSSESNSRSATTPAAAPVKAIDLFDTKVQKALETIDEDTFKPES
FFSSRDSKETSDKVIIDLNNETVTVASKPATAVRNEDVIFHPNFLGDPDM
KAEKWLRKLYNYRQKYMQE*

GH08125.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11808-PA 219 CG11808-PA 1..219 1..219 1108 100 Plus
CG12877-PC 991 CG12877-PC 200..326 1..123 213 41.5 Plus
SF1-PC 323 CG5836-PC 53..217 2..144 192 36.5 Plus
SF1-PB 347 CG5836-PB 53..217 2..144 192 36.5 Plus
SF1-PA 787 CG5836-PA 53..217 2..144 192 36.5 Plus
CG12877-PC 991 CG12877-PC 170..295 2..115 176 34.9 Plus
CG12877-PC 991 CG12877-PC 221..350 2..131 166 33.6 Plus

GH08125.pep Sequence

Translation from 33 to 692

> GH08125.pep
MRDRDRRDRDRDRERDRDRDRERDRERDRDRRHRSKSPSRSSRQVSKPKK
KKAKKSKKYSRRSRSSSRSTSRSSSSSRSSSRSTHSKSRTRDHHKSRSIS
QRKTRGPSSESNSRSATTPAAAPVKAIDLFDTKVQKALETIDEDTFKPES
FFSSRDSKETSDKVIIDLNNETVTVASKPATAVRNEDVIFHPNFLGDPDM
KAEKWLRKLYNYRQKYMQE*

GH08125.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12317-PA 242 GF12317-PA 55..242 33..219 465 77.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20504-PA 221 GG20504-PA 35..221 33..219 676 91.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21114-PA 236 GH21114-PA 113..236 101..219 399 65.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG11808-PA 219 CG11808-PA 1..219 1..219 1108 100 Plus
CG12877-PC 991 CG12877-PC 200..326 1..123 213 41.5 Plus
SF1-PC 323 CG5836-PC 53..217 2..144 192 36.5 Plus
SF1-PB 347 CG5836-PB 53..217 2..144 192 36.5 Plus
SF1-PA 787 CG5836-PA 53..217 2..144 192 36.5 Plus
CG10600-PC 1376 CG10600-PC 199..353 7..163 188 33.5 Plus
CG10600-PA 1377 CG10600-PA 200..354 7..163 188 33.5 Plus
CG10600-PB 1406 CG10600-PB 229..383 7..163 188 33.5 Plus
CG12877-PC 991 CG12877-PC 170..295 2..115 176 34.9 Plus
Fip1-PA 701 CG1078-PA 606..696 2..92 175 35.9 Plus
CG6227-PA 1224 CG6227-PA 7..184 2..144 175 31.1 Plus
CG3918-PA 321 CG3918-PA 90..258 2..161 174 28.4 Plus
B52-PN 350 CG10851-PN 211..340 2..113 174 39.7 Plus
B52-PC 350 CG10851-PC 211..340 2..113 174 39.7 Plus
B52-PA 350 CG10851-PA 211..340 2..113 174 39.7 Plus
B52-PO 355 CG10851-PO 216..345 2..113 174 39.7 Plus
B52-PM 355 CG10851-PM 216..345 2..113 174 39.7 Plus
Xe7-PD 777 CG2179-PD 587..722 2..145 174 32.9 Plus
Fip1-PA 701 CG1078-PA 616..700 2..92 169 35.9 Plus
BOD1-PC 1109 CG5514-PC 600..712 2..112 169 38.9 Plus
BOD1-PA 1109 CG5514-PA 600..712 2..112 169 38.9 Plus
BOD1-PD 1150 CG5514-PD 600..712 2..112 169 38.9 Plus
BOD1-PB 1150 CG5514-PB 600..712 2..112 169 38.9 Plus
BOD1-PE 1151 CG5514-PE 600..712 2..112 169 38.9 Plus
Fip1-PA 701 CG1078-PA 591..692 2..116 168 34.8 Plus
CG6695-PB 715 CG6695-PB 407..523 1..116 168 38.1 Plus
CG6695-PA 961 CG6695-PA 407..523 1..116 168 38.1 Plus
Srp54-PA 513 CG4602-PA 325..513 4..179 167 32.8 Plus
CG12877-PC 991 CG12877-PC 221..350 2..131 166 33.6 Plus
B52-PN 350 CG10851-PN 200..323 2..126 166 36 Plus
B52-PC 350 CG10851-PC 200..323 2..126 166 36 Plus
B52-PA 350 CG10851-PA 200..323 2..126 166 36 Plus
B52-PO 355 CG10851-PO 205..328 2..126 166 36 Plus
B52-PM 355 CG10851-PM 205..328 2..126 166 36 Plus
CG31211-PA 874 CG31211-PA 750..872 7..125 166 35.4 Plus
CG31211-PB 893 CG31211-PB 769..891 7..125 166 35.4 Plus
CG31211-PA 874 CG31211-PA 754..870 5..119 164 38.8 Plus
CG31211-PB 893 CG31211-PB 773..889 5..119 164 38.8 Plus
cactin-PB 720 CG1676-PB 18..92 4..79 162 51.9 Plus
CG9915-PC 820 CG9915-PC 334..546 4..208 161 27.8 Plus
CG9915-PB 820 CG9915-PB 334..546 4..208 161 27.8 Plus
stc-PC 1095 CG3647-PC 224..338 2..114 161 35.6 Plus
stc-PA 1099 CG3647-PA 228..342 2..114 161 35.6 Plus
stc-PD 1102 CG3647-PD 231..345 2..114 161 35.6 Plus
stc-PB 1106 CG3647-PB 235..349 2..114 161 35.6 Plus
Srp54-PA 513 CG4602-PA 278..390 1..118 159 39.5 Plus
B52-PB 329 CG10851-PB 205..317 2..115 159 36.8 Plus
Xe7-PA 783 CG2179-PA 573..728 5..145 156 32.7 Plus
CG6340-PB 513 CG6340-PB 156..275 8..125 155 36.9 Plus
B52-PB 329 CG10851-PB 216..318 2..91 153 42.3 Plus
CG6340-PB 513 CG6340-PB 102..237 4..117 153 31.6 Plus
CG18809-PD 362 CG18809-PD 79..160 2..81 153 39 Plus
CG18809-PC 362 CG18809-PC 79..160 2..81 153 39 Plus
CG18809-PB 362 CG18809-PB 79..160 2..81 153 39 Plus
CG18809-PA 362 CG18809-PA 79..160 2..81 153 39 Plus
CG34398-PI 1702 CG34398-PI 1385..1545 4..179 151 30.7 Plus
CG34398-PL 1757 CG34398-PL 1440..1600 4..179 151 30.7 Plus
CG34398-PH 1930 CG34398-PH 1613..1773 4..179 151 30.7 Plus
CG34398-PA 1930 CG34398-PA 1613..1773 4..179 151 30.7 Plus
CG9915-PC 820 CG9915-PC 156..274 2..117 150 35.8 Plus
CG9915-PB 820 CG9915-PB 156..274 2..117 150 35.8 Plus
Caper-PB 594 CG11266-PB 98..226 2..119 150 36.1 Plus
Caper-PA 594 CG11266-PA 98..226 2..119 150 36.1 Plus
PNUTS-PA 628 CG33526-PA 289..403 7..116 150 32.2 Plus
PNUTS-PB 628 CG33526-PB 289..403 7..116 150 32.2 Plus
PNUTS-PE 1135 CG33526-PE 289..403 7..116 150 32.2 Plus
PNUTS-PD 1135 CG33526-PD 289..403 7..116 150 32.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18720-PA 234 GI18720-PA 110..234 95..219 423 68.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10616-PA 212 GL10616-PA 29..212 33..219 447 68.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11212-PA 212 GA11212-PA 29..212 33..219 448 68.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21597-PA 219 GM21597-PA 92..219 92..219 657 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11103-PA 219 GD11103-PA 92..219 92..219 651 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21738-PA 232 GJ21738-PA 114..232 101..219 424 68.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19441-PA 225 GK19441-PA 94..225 94..219 445 69.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13638-PA 221 GE13638-PA 35..221 33..219 663 91.4 Plus