GH08251.complete Sequence
311 bp (311 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118754
> GH08251.complete
CAACAAACCAGCTTTACCATGAAGTTCCTACTCGTGTGCACTCTCATCCT
GGGCCTCGCCTTCTTCATGGCCTCTGCCCTTCCCCAACTGAACAACGAGG
CCCCCATGGTTGGCGATGACCATCACCACCACCCGGTGGTCCGCAGCGTT
CACTTCGCCGAGGACGTTCAGGCTCAGCACAAGCACGATGACGTCGCCTG
CTGCGGCTAGACATCTCCATTTGGAGCAAGGCGTGACGGCAACTTCATCG
ATCTTAAACCGCCTTTAACTTTTAATAAAGAGCAATATTGAACAAAAAAA
AAAAAAAAAAA
GH08251.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:04:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-RA | 370 | CG18628-RA | 67..362 | 1..296 | 1480 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:57:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 10631308..10631525 | 76..293 | 1075 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 10631170..10631245 | 1..76 | 380 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:57:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 10639919..10640139 | 76..296 | 1105 | 100 | Plus |
3L | 28110227 | 3L | 10639781..10639856 | 1..76 | 380 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 10633019..10633239 | 76..296 | 1105 | 100 | Plus |
3L | 28103327 | 3L | 10632881..10632956 | 1..76 | 380 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 08:57:10 has no hits.
GH08251.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:58:17 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 10631170..10631245 | 1..76 | 100 | -> | Plus |
chr3L | 10631309..10631525 | 77..293 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:26:43 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 1..192 | 19..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:30 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 1..192 | 19..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:32:19 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 1..192 | 19..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:46 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 1..192 | 19..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:54:28 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 1..192 | 19..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:10 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 11..303 | 1..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:30 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 11..303 | 1..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:32:19 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 42..334 | 1..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:46 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 11..303 | 1..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:54:28 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 42..334 | 1..293 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:17 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 10639781..10639856 | 1..76 | 100 | -> | Plus |
3L | 10639920..10640136 | 77..293 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:17 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 10639781..10639856 | 1..76 | 100 | -> | Plus |
3L | 10639920..10640136 | 77..293 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:17 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 10639781..10639856 | 1..76 | 100 | -> | Plus |
3L | 10639920..10640136 | 77..293 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:32:19 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 10632881..10632956 | 1..76 | 100 | -> | Plus |
arm_3L | 10633020..10633236 | 77..293 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:11 Download gff for
GH08251.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 10633020..10633236 | 77..293 | 100 | | Plus |
3L | 10632881..10632956 | 1..76 | 100 | -> | Plus |
GH08251.hyp Sequence
Translation from 1 to 209
> GH08251.hyp
QQTSFTMKFLLVCTLILGLAFFMASALPQLNNEAPMVGDDHHHHPVVRSV
HFAEDVQAQHKHDDVACCG*
GH08251.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:35:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-PA | 63 | CG18628-PA | 1..63 | 7..69 | 344 | 100 | Plus |
GH08251.pep Sequence
Translation from 18 to 209
> GH08251.pep
MKFLLVCTLILGLAFFMASALPQLNNEAPMVGDDHHHHPVVRSVHFAEDV
QAQHKHDDVACCG*
GH08251.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:02:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10600-PA | 62 | GF10600-PA | 1..62 | 1..63 | 153 | 51.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:02:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15443-PA | 64 | GG15443-PA | 1..64 | 1..63 | 299 | 93.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-PA | 63 | CG18628-PA | 1..63 | 1..63 | 344 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:02:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25218-PA | 68 | GM25218-PA | 1..68 | 1..63 | 275 | 85.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:02:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14251-PA | 63 | GD14251-PA | 1..63 | 1..63 | 319 | 98.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:02:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK12276-PA | 66 | GK12276-PA | 1..66 | 1..63 | 140 | 50 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:02:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21753-PA | 64 | GE21753-PA | 1..64 | 1..63 | 282 | 89.1 | Plus |