Clone GH08251 Report

Search the DGRC for GH08251

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:82
Well:51
Vector:pOT2
Associated Gene/TranscriptCG18628-RA
Protein status:GH08251.pep: gold
Preliminary Size:305
Sequenced Size:311

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18628 2002-01-01 Sim4 clustering to Release 2
CG18628 2002-05-18 Blastp of sequenced clone
CG18628 2008-04-29 Release 5.5 accounting
CG18628 2008-08-15 Release 5.9 accounting
CG18628 2008-12-18 5.12 accounting

Clone Sequence Records

GH08251.complete Sequence

311 bp (311 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118754

> GH08251.complete
CAACAAACCAGCTTTACCATGAAGTTCCTACTCGTGTGCACTCTCATCCT
GGGCCTCGCCTTCTTCATGGCCTCTGCCCTTCCCCAACTGAACAACGAGG
CCCCCATGGTTGGCGATGACCATCACCACCACCCGGTGGTCCGCAGCGTT
CACTTCGCCGAGGACGTTCAGGCTCAGCACAAGCACGATGACGTCGCCTG
CTGCGGCTAGACATCTCCATTTGGAGCAAGGCGTGACGGCAACTTCATCG
ATCTTAAACCGCCTTTAACTTTTAATAAAGAGCAATATTGAACAAAAAAA
AAAAAAAAAAA

GH08251.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-RA 370 CG18628-RA 67..362 1..296 1480 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10631308..10631525 76..293 1075 99.5 Plus
chr3L 24539361 chr3L 10631170..10631245 1..76 380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10639919..10640139 76..296 1105 100 Plus
3L 28110227 3L 10639781..10639856 1..76 380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10633019..10633239 76..296 1105 100 Plus
3L 28103327 3L 10632881..10632956 1..76 380 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:57:10 has no hits.

GH08251.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:58:17 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10631170..10631245 1..76 100 -> Plus
chr3L 10631309..10631525 77..293 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:26:43 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 1..192 19..210 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:30 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 1..192 19..210 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:32:19 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 1..192 19..210 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:46 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 1..192 19..210 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:54:28 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 1..192 19..210 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:10 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 11..303 1..293 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:30 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 11..303 1..293 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:32:19 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 42..334 1..293 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:46 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 11..303 1..293 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:54:28 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 42..334 1..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:17 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10639781..10639856 1..76 100 -> Plus
3L 10639920..10640136 77..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:17 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10639781..10639856 1..76 100 -> Plus
3L 10639920..10640136 77..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:17 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10639781..10639856 1..76 100 -> Plus
3L 10639920..10640136 77..293 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:32:19 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10632881..10632956 1..76 100 -> Plus
arm_3L 10633020..10633236 77..293 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:11 Download gff for GH08251.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10633020..10633236 77..293 100   Plus
3L 10632881..10632956 1..76 100 -> Plus

GH08251.hyp Sequence

Translation from 1 to 209

> GH08251.hyp
QQTSFTMKFLLVCTLILGLAFFMASALPQLNNEAPMVGDDHHHHPVVRSV
HFAEDVQAQHKHDDVACCG*

GH08251.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-PA 63 CG18628-PA 1..63 7..69 344 100 Plus

GH08251.pep Sequence

Translation from 18 to 209

> GH08251.pep
MKFLLVCTLILGLAFFMASALPQLNNEAPMVGDDHHHHPVVRSVHFAEDV
QAQHKHDDVACCG*

GH08251.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10600-PA 62 GF10600-PA 1..62 1..63 153 51.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15443-PA 64 GG15443-PA 1..64 1..63 299 93.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-PA 63 CG18628-PA 1..63 1..63 344 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25218-PA 68 GM25218-PA 1..68 1..63 275 85.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14251-PA 63 GD14251-PA 1..63 1..63 319 98.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12276-PA 66 GK12276-PA 1..66 1..63 140 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21753-PA 64 GE21753-PA 1..64 1..63 282 89.1 Plus