Clone GH08336 Report

Search the DGRC for GH08336

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:83
Well:36
Vector:pOT2
Associated Gene/TranscriptCG31207-RA
Protein status:GH08336.pep: gold
Preliminary Size:1066
Sequenced Size:903

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7096 2002-01-01 Sim4 clustering to Release 2
CG31207 2002-05-14 Blastp of sequenced clone
CG31207 2003-01-01 Sim4 clustering to Release 3
CG31207 2008-04-29 Release 5.5 accounting
CG31207 2008-08-15 Release 5.9 accounting
CG31207 2008-12-18 5.12 accounting

Clone Sequence Records

GH08336.complete Sequence

903 bp (903 high quality bases) assembled on 2002-05-14

GenBank Submission: AY118755

> GH08336.complete
CACTGGAAGTCAACATGGAATACTAGTGGCACAAATATATCAAAATGAAA
GATACAATAATCGTTCTGGTGCTCCTGCAGATCATCGGATCGTTGCAAGG
CCAAATTCTCCCAAAGGAAATTAAGAAGTGCCGCTTTGGAGATTCTAAGT
GCATTGTTAATTCCATGAATGCTATAATAAAGAATTATCCCAAAGGCATA
CCGGCGATCGGATTGAAGCCCATTGATGTGGTGGACATTAGGGACTCAAA
GTTCTGGAATGATGCAATGGTAGGCGCCTTCTGGTTGAACTTCGATCTGT
TCAATCAAGTGAACTACGGCTTCGAGAACACGACGATCACGAAGGTCAGT
GGGTTTGATGAGAATCCCACATCCAGCTTGATTGAAATACACGGCCGGAT
ACCCAGTCTAATCCATAAGGGCGATTACTTCAGTATGGGAAGGGTGTGGA
TTGTACAGATGAATTCCACGGGGGAATCCCTTTCGGATTTTCAGAACTTT
CGCTTTGTTCTCAAATTGAAGGTCATAATGGAGTATCGCAATAATAAGCG
CTACTTGAAGATATACGAGCTAACCCCCTTCGTGACCATGGACCGATGGG
TATTCTGGCTAGACAACTTTTTCGAATCCAACACGGATATGACGATAGCC
ATTAATCAGGTGTTCAATCTGCACTGGGTTGAGTTTTGGAACGAGCTGGA
GCCCACAAACCTGAAAATATTCGCCGGTGTGTTTCGCTCCGTTTTCGAGG
ATATTTTCAAAAAGGTCCCATACGATGACATGTTCTTACCGATTTCCAAA
GAGTTCGAAGTAAATGATTAAAGGTGATTAAAGATAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

GH08336.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31207-RA 1029 CG31207-RA 80..915 1..836 4180 100 Plus
CG7079-RA 1371 CG7079-RA 542..648 289..395 205 79.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16870196..16870679 595..112 2285 98.1 Minus
chr3R 27901430 chr3R 16869892..16870132 835..595 1175 99.2 Minus
chr3R 27901430 chr3R 16870778..16870888 111..1 540 99.1 Minus
chr3R 27901430 chr3R 16872176..16872282 395..289 205 79.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21046336..21046819 595..112 2420 100 Minus
3R 32079331 3R 21046031..21046272 836..595 1210 100 Minus
3R 32079331 3R 21046917..21047027 111..1 555 100 Minus
3R 32079331 3R 21048315..21048421 395..289 205 79.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20787167..20787650 595..112 2420 100 Minus
3R 31820162 3R 20786862..20787103 836..595 1210 100 Minus
3R 31820162 3R 20787748..20787858 111..1 555 100 Minus
3R 31820162 3R 20789146..20789252 395..289 205 79.4 Minus
Blast to na_te.dros performed on 2019-03-16 18:04:02 has no hits.

GH08336.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:04:44 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16869892..16870131 596..835 99 <- Minus
chr3R 16870196..16870679 112..595 98 <- Minus
chr3R 16870778..16870888 1..111 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:26:58 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..777 45..821 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:52:21 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..777 45..821 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:27 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..777 45..821 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:00 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..777 45..821 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:29:06 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..777 45..821 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:30:29 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 4..838 1..835 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:52:21 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..835 1..835 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:27 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..835 1..835 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:00 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 4..838 1..835 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:29:06 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
CG31207-RA 1..835 1..835 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:44 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21046032..21046271 596..835 100 <- Minus
3R 21046336..21046819 112..595 100 <- Minus
3R 21046917..21047027 1..111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:44 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21046032..21046271 596..835 100 <- Minus
3R 21046336..21046819 112..595 100 <- Minus
3R 21046917..21047027 1..111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:44 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21046032..21046271 596..835 100 <- Minus
3R 21046336..21046819 112..595 100 <- Minus
3R 21046917..21047027 1..111 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:27 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16872058..16872541 112..595 100 <- Minus
arm_3R 16872639..16872749 1..111 100   Minus
arm_3R 16871754..16871993 596..835 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:17:23 Download gff for GH08336.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20786863..20787102 596..835 100 <- Minus
3R 20787167..20787650 112..595 100 <- Minus
3R 20787748..20787858 1..111 100   Minus

GH08336.hyp Sequence

Translation from 44 to 820

> GH08336.hyp
MKDTIIVLVLLQIIGSLQGQILPKEIKKCRFGDSKCIVNSMNAIIKNYPK
GIPAIGLKPIDVVDIRDSKFWNDAMVGAFWLNFDLFNQVNYGFENTTITK
VSGFDENPTSSLIEIHGRIPSLIHKGDYFSMGRVWIVQMNSTGESLSDFQ
NFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVFWLDNFFESNTDMT
IAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMFLPI
SKEFEVND*

GH08336.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG31207-PA 258 CG31207-PA 1..258 1..258 1369 100 Plus
CG7079-PB 255 CG7079-PB 7..249 7..248 824 59.3 Plus
CG7079-PA 255 CG7079-PA 7..249 7..248 824 59.3 Plus
CG31189-PB 258 CG31189-PB 18..250 17..249 634 48.1 Plus
CG11852-PA 250 CG11852-PA 23..248 23..248 298 28.9 Plus

GH08336.pep Sequence

Translation from 44 to 820

> GH08336.pep
MKDTIIVLVLLQIIGSLQGQILPKEIKKCRFGDSKCIVNSMNAIIKNYPK
GIPAIGLKPIDVVDIRDSKFWNDAMVGAFWLNFDLFNQVNYGFENTTITK
VSGFDENPTSSLIEIHGRIPSLIHKGDYFSMGRVWIVQMNSTGESLSDFQ
NFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVFWLDNFFESNTDMT
IAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMFLPI
SKEFEVND*

GH08336.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18526-PA 258 GF18526-PA 1..258 1..258 1082 77.5 Plus
Dana\GF18525-PA 258 GF18525-PA 1..258 1..258 1050 74 Plus
Dana\GF18524-PA 253 GF18524-PA 8..249 8..248 782 58.7 Plus
Dana\GF11740-PA 251 GF11740-PA 22..248 22..248 382 35.7 Plus
Dana\GF17552-PA 250 GF17552-PA 23..248 23..248 286 27.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14982-PA 258 GG14982-PA 1..258 1..258 1280 92.6 Plus
Dere\GG14970-PA 255 GG14970-PA 7..249 7..248 779 56.8 Plus
Dere\GG14993-PA 263 GG14993-PA 21..255 15..249 605 45.5 Plus
Dere\GG11378-PA 250 GG11378-PA 23..248 23..248 306 28.5 Plus
Dere\GG14959-PA 213 GG14959-PA 6..211 19..247 243 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16804-PA 243 GH16804-PA 2..234 17..248 713 58.8 Plus
Dgri\GH23203-PA 234 GH23203-PA 1..226 26..251 609 47.8 Plus
Dgri\GH17380-PA 248 GH17380-PA 21..246 23..248 297 27.6 Plus
Dgri\GH12677-PA 257 GH12677-PA 13..255 8..247 169 20.2 Plus
Dgri\GH17382-PA 259 GH17382-PA 25..250 22..247 165 23.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31207-PA 258 CG31207-PA 1..258 1..258 1369 100 Plus
CG7079-PB 255 CG7079-PB 7..249 7..248 824 59.3 Plus
CG7079-PA 255 CG7079-PA 7..249 7..248 824 59.3 Plus
CG31189-PB 258 CG31189-PB 18..250 17..249 634 48.1 Plus
CG11852-PA 250 CG11852-PA 23..248 23..248 298 28.9 Plus
CG17279-PD 245 CG17279-PD 3..243 5..247 280 29.5 Plus
CG11854-PB 250 CG11854-PB 5..249 6..248 213 26.2 Plus
to-PB 249 CG11853-PB 4..245 5..247 169 22 Plus
to-PA 249 CG11853-PA 4..245 5..247 169 22 Plus
CG13618-PA 252 CG13618-PA 11..251 5..248 158 22.4 Plus
CG2016-PD 249 CG2016-PD 1..244 1..245 150 21.7 Plus
CG2016-PB 249 CG2016-PB 1..244 1..245 150 21.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10308-PA 253 GI10308-PA 1..248 1..248 845 58.9 Plus
Dmoj\GI10307-PA 256 GI10307-PA 1..249 1..248 772 58.6 Plus
Dmoj\GI10309-PA 228 GI10309-PA 1..225 25..249 601 48.9 Plus
Dmoj\GI21090-PA 232 GI21090-PA 9..229 25..247 492 41.7 Plus
Dmoj\GI23924-PA 255 GI23924-PA 20..253 15..248 291 26.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12688-PA 258 GL12688-PA 1..258 1..258 1078 76.7 Plus
Dper\GL12687-PA 256 GL12687-PA 7..254 6..252 764 57.7 Plus
Dper\GL12689-PA 262 GL12689-PA 7..251 5..249 652 48.2 Plus
Dper\GL11987-PA 250 GL11987-PA 23..248 23..248 315 28.5 Plus
Dper\GL12686-PA 243 GL12686-PA 17..241 19..247 292 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16093-PA 258 GA16093-PA 1..258 1..258 1085 77.1 Plus
Dpse\GA20085-PA 256 GA20085-PA 7..254 6..252 766 57.7 Plus
Dpse\GA16076-PA 262 GA16076-PA 7..251 5..249 652 48.2 Plus
Dpse\GA11236-PA 250 GA11236-PA 23..248 23..248 315 28.5 Plus
Dpse\GA27589-PA 227 GA27589-PA 2..225 20..247 261 27.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15112-PA 258 GM15112-PA 1..258 1..258 1327 97.7 Plus
Dsec\GM15111-PA 255 GM15111-PA 7..249 7..248 806 59.3 Plus
Dsec\GM15113-PA 263 GM15113-PA 21..255 15..249 599 46.4 Plus
Dsec\GM17820-PA 250 GM17820-PA 23..248 23..248 303 28.5 Plus
Dsec\GM15110-PA 224 GM15110-PA 3..222 5..247 252 27 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20016-PA 258 GD20016-PA 1..258 1..258 1327 97.7 Plus
Dsim\GD20015-PA 255 GD20015-PA 7..249 7..248 789 58.4 Plus
Dsim\GD20018-PA 205 GD20018-PA 1..197 53..249 471 45.2 Plus
Dsim\GD21189-PA 250 GD21189-PA 23..248 23..248 308 28.9 Plus
Dsim\GD21191-PA 250 GD21191-PA 23..249 22..248 224 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10162-PA 257 GJ10162-PA 1..256 1..257 882 61.5 Plus
Dvir\GJ10161-PA 258 GJ10161-PA 1..257 1..258 763 54.4 Plus
Dvir\GJ10163-PA 256 GJ10163-PA 6..256 5..255 666 49 Plus
Dvir\GJ11684-PA 210 GJ11684-PA 11..207 53..249 617 57.4 Plus
Dvir\GJ20936-PA 327 GJ20936-PA 84..326 11..249 538 42.4 Plus
Dvir\GJ20936-PA 327 GJ20936-PA 8..99 136..227 228 44.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14315-PA 258 GK14315-PA 1..257 1..257 936 65 Plus
Dwil\GK14312-PA 253 GK14312-PA 1..249 1..248 748 55.4 Plus
Dwil\GK14313-PA 240 GK14313-PA 1..219 25..243 738 58 Plus
Dwil\GK14318-PA 261 GK14318-PA 20..249 19..248 620 49.6 Plus
Dwil\GK13450-PA 250 GK13450-PA 6..248 5..248 294 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25023-PA 258 GE25023-PA 1..258 1..258 1271 93.4 Plus
Dyak\GE25022-PA 254 GE25022-PA 7..249 7..248 780 57.2 Plus
Dyak\GE23575-PA 251 GE23575-PA 24..249 23..248 304 28.9 Plus
Dyak\GE25021-PA 245 GE25021-PA 3..243 5..247 270 27.5 Plus
Dyak\GE23577-PA 250 GE23577-PA 5..249 6..248 229 25.8 Plus