Clone GH08387 Report

Search the DGRC for GH08387

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:83
Well:87
Vector:pOT2
Associated Gene/TranscriptSpdS-RB
Protein status:GH08387.pep: gold
Preliminary Size:1569
Sequenced Size:1471

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8327 2001-01-01 Release 2 assignment
CG8327 2001-07-04 Blastp of sequenced clone
CG8327 2003-01-01 Sim4 clustering to Release 3
SpdS 2008-04-29 Release 5.5 accounting

Clone Sequence Records

GH08387.complete Sequence

1471 bp (1471 high quality bases) assembled on 2001-07-04

GenBank Submission: AY059440

> GH08387.complete
CGGATGGTTCAGCGAACTGCAGGCCGATCTCTGGCCCGGTCAGTCATTCT
CCCTGAAAGTCAAGGAGGTCATCCACAAGGAGAAGTCCCGGTTCCAAGAC
ATCCAGATCGTTGAAACGTAAGATAAATAATAGATAAACAAATACTTGGA
CACACAACCCCATTTGTTTACATCCGAAATTCCTCAGTCTAGACTGAAGT
TTGAAGATAGATGTCAAAATAAATTAGCTTAGATTGAGATTAAAAAACTA
AATTAAAATCATTATAAACACGCAAGTCACACAAATCCGAAATTTTTAAC
AGCTTAAGCTGTTGAGATTTTAAGGACTAACCTACAATAGCCTAATCCCA
TATGTATCCTACATTGAAGGTCCCTAAATCATAGATTGTAGAAATCGAAA
ATTTTCCACTGGTTGTTCAAACACAAATTGCCCAGCCAGCATTTTCGGAC
CCTTTGGTTTTCGTGTGTTTATTCTTGATCTGCACCAACAGCCTTATCGA
TGGAGTCATCTAGGGCCAAAAACGACAGACAGAATACTGATAGCAAGTCA
GCTCGTCTTTCAGGTTTGAGTTCCTCCAGTCGAACATTGGGTACACTTGC
GCCGCTGAAAAAATCAATAATTCGATAATTCTATTACAGCGAAACCTATG
GACGGTGCCTAATTCTGGACGGAATCATTCAGTGCACGGCCAGGGATGAG
TTCTCGTACCAGGAGATGATATCTTTCCTGCCGCTCTGCGCCCATCCCAA
TCCCAAAAAGGTCCTGATCGTGGGCGGTGGCGATGGCGGCGTTGCTCGCG
AGGTGGTAAAGCATCCACTGGTCGAGGAAGTGCATCAGGTGGAAATCGAC
GACCGTGTCGTCGAGCTGTCCAAGCAATATCTCCCAGCGATGGCCTGTGG
TTTCGCCAACGAGAAGTTGAAGCTTACCATTGGCGATGGATTCGACTATA
TGAAGAAACACAAGAACGAATTTGATGTCATCATCACCGACAGCTCGGAT
CCCATTGGTCCGGCAGTGAGCCTGTTTCAGGAAAGCTACTACGAGCTAAT
GAAACACGCGCTGAAGGATGACGGAATCGTGTGCTCCCAGGGCGGTAGCT
TCTGGCTGGACCTGGACTACATCAAGAAGACCATGTCCGGCTGCAAGGAG
CACTTTGCTAAGGTGGCCTATGCCGTCACCTCCGTTCCGTCCTATCCCTG
CGGCCACATTGGCTTCGTCATGGGCTCCCTGAACAAAAACCAGGACTTCG
CTACTCCCAAGCTTGGAAAGTCCGAAATCGATTCTATAGACCTAAGGTAC
TACTCCTCCGAGGTTCACTCCGCCGCCTTTGCCTTGCCTCGATGGGTGCA
GAAGCACTTTTACGAATGACCAGGTTGCGGAAAGATTCGTGTGTATCTGT
TTGTTAAAAATAAATATGATAATAATATGACTTGTTTATCATCGCTTCTT
AAAAAAAAAAAAAAAAAAAAA

GH08387.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
SpdS.a 1450 SpdS.a 1..1450 1..1450 7250 100 Plus
SpdS.b 1889 SpdS.b 590..1406 637..1453 4085 100 Plus
SpdS-RB 1707 SpdS-RB 408..1224 637..1453 4085 100 Plus
SpdS.b 1889 SpdS.b 217..592 188..563 1880 100 Plus
SpdS-RB 1707 SpdS-RB 217..410 370..563 970 100 Plus
SpdS-RB 1707 SpdS-RB 100..218 1..119 595 100 Plus
SpdS.b 1889 SpdS.b 100..216 1..117 585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5457552..5459001 1..1450 7235 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9631738..9633190 1..1453 7265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9372569..9374021 1..1453 7265 100 Plus
Blast to na_te.dros performed 2019-03-16 08:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\mini-me 4622 Dpse\mini-me DPSEMINIME 4622bp 83..151 443..511 147 68.1 Plus
Dfun\Isfun-1 928 Dfun\Isfun-1 DFU309320 928bp Derived from AJ309320 (Rel. 68, Last updated, Version 1). 82..130 463..511 137 75.5 Plus
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 3077..3169 511..415 134 61.9 Minus
Dsub\SGM 823 Dsub\SGM SGM 823bp Derived from AF043638. 101..149 463..511 128 73.5 Plus
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 81..126 466..511 113 71.7 Plus

GH08387.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:58:04 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5457552..5459001 1..1450 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:27:12 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 135..864 640..1369 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:28:50 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 135..864 640..1369 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:55:08 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 135..864 640..1369 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:13 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 135..864 640..1369 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:53:50 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RA 135..864 640..1369 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:29:01 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RB 190..382 364..555 98 == Plus
SpdS-RB 383..1201 630..1450 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:28:50 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RB 210..402 364..555 98 == Plus
SpdS-RB 403..1221 630..1450 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:55:08 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RB 178..370 364..555 98 == Plus
SpdS-RB 371..1189 630..1450 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:13 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RB 190..382 364..555 98 == Plus
SpdS-RB 383..1201 630..1450 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:53:50 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
SpdS-RB 178..370 364..555 98 == Plus
SpdS-RB 371..1189 630..1450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:04 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9631738..9633187 1..1450 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:04 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9631738..9633187 1..1450 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:58:04 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9631738..9633187 1..1450 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:55:08 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5457460..5458909 1..1450 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:40:11 Download gff for GH08387.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9372569..9374018 1..1450 100   Plus

GH08387.hyp Sequence

Translation from 715 to 1368

> GH08387.hyp
MISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVE
LSKQYLPAMACGFANEKLKLTIGDGFDYMKKHKNEFDVIITDSSDPIGPA
VSLFQESYYELMKHALKDDGIVCSQGGSFWLDLDYIKKTMSGCKEHFAKV
AYAVTSVPSYPCGHIGFVMGSLNKNQDFATPKLGKSEIDSIDLRYYSSEV
HSAAFALPRWVQKHFYE*

GH08387.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
SpdS-PB 217 CG8327-PB 1..217 1..217 1155 100 Plus
SpdS-PC 287 CG8327-PC 71..287 1..217 1155 100 Plus
SpdS-PA 287 CG8327-PA 71..287 1..217 1155 100 Plus

GH08387.pep Sequence

Translation from 715 to 1368

> GH08387.pep
MISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVE
LSKQYLPAMACGFANEKLKLTIGDGFDYMKKHKNEFDVIITDSSDPIGPA
VSLFQESYYELMKHALKDDGIVCSQGGSFWLDLDYIKKTMSGCKEHFAKV
AYAVTSVPSYPCGHIGFVMGSLNKNQDFATPKLGKSEIDSIDLRYYSSEV
HSAAFALPRWVQKHFYE*

GH08387.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16181-PA 287 GF16181-PA 71..286 1..216 1111 94.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16982-PA 287 GG16982-PA 71..287 1..217 1144 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18040-PA 289 GH18040-PA 71..289 1..217 948 79 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
SpdS-PB 217 CG8327-PB 1..217 1..217 1155 100 Plus
SpdS-PC 287 CG8327-PC 71..287 1..217 1155 100 Plus
SpdS-PA 287 CG8327-PA 71..287 1..217 1155 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23961-PA 289 GI23961-PA 71..289 1..217 937 76.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21885-PA 197 GL21885-PA 71..195 1..125 600 89.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20990-PA 292 GA20990-PA 71..285 1..213 966 82.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23823-PA 287 GM23823-PA 71..287 1..217 1144 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18634-PA 279 GD18634-PA 71..279 1..217 950 85.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11148-PA 304 GJ11148-PA 83..299 1..215 906 73.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10845-PA 289 GK10845-PA 71..289 1..217 1005 85.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25970-PA 287 GE25970-PA 71..287 1..217 1151 98.6 Plus