Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
GH08412.complete Sequence
317 bp assembled on 2008-12-09
GenBank Submission: BT053698.1
> GH08412.complete
ACAAGATGAACGTATTCAATGGTTTCTTGCTAGTCTTCCTGGGCCTGGCC
CTCAGCTCTGTGGATGCACAGATAGCAACACGCCAGGAAACCTCGGAGGA
CAAGGCTTGTGGTCCCCACGCCTACTACAATTACGCCCGGCACACTTGCC
TGCCATTCTAGGAACCTTTCCAAAGTGTCCTATGCCTAAAGAAATAAAAC
GTTAAGGTACTAAATGTACCAGAAATTAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA
GH08412.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:14:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Ca-RA | 242 | Met75Ca-RA | 16..242 | 1..227 | 1135 | 100 | Plus |
Met75Cb-RA | 241 | Met75Cb-RA | 16..241 | 1..226 | 1130 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:06:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 18461723..18461949 | 227..1 | 1135 | 100 | Minus |
chr3L | 24539361 | chr3L | 18458958..18459183 | 226..1 | 1130 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 18472141..18472369 | 229..1 | 1145 | 100 | Minus |
3L | 28110227 | 3L | 18469378..18469603 | 226..1 | 1130 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 18465241..18465469 | 229..1 | 1145 | 100 | Minus |
3L | 28103327 | 3L | 18462478..18462703 | 226..1 | 1130 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 21:06:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Stalker4 | 7359 | Stalker4 STALKER4 7359bp | 486..514 | 173..201 | 100 | 82.8 | Plus |
GH08412.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:07:03 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 18461723..18461949 | 1..227 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:53 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 1..156 | 6..161 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:48 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Cb-RA | 1..156 | 6..161 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:37:59 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 1..156 | 6..161 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:51 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Cb-RA | 1..156 | 6..161 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 12:05:42 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Cb-RA | 1..222 | 5..226 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:48 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 16..242 | 1..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:37:59 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 16..242 | 1..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:51 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 16..242 | 1..227 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:03 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18472143..18472369 | 1..227 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:03 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18472143..18472369 | 1..227 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:03 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18472143..18472369 | 1..227 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:37:59 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 18465243..18465469 | 1..227 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:27 Download gff for
GH08412.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18465243..18465469 | 1..227 | 100 | | Minus |
GH08412.hyp Sequence
Translation from 1 to 204
> GH08412.hyp
QDERIQWFLASLPGPGPQLCGCTDSNTPGNLGGQGLWSPRLLQLRPAHLP
AILGTFPKCPMPKEIKR*
Sequence GH08412.hyp has no blast hits.
GH08412.pep Sequence
Translation from 2 to 160
> GH08412.pep
KMNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCL
PF*
GH08412.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:02:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20134-PA | 51 | GF20134-PA | 1..51 | 2..52 | 135 | 60.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:02:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15740-PA | 51 | GG15740-PA | 1..51 | 2..52 | 168 | 80.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Cb-PA | 51 | CG18064-PA | 1..51 | 2..52 | 272 | 100 | Plus |
Met75Ca-PA | 51 | CG32197-PA | 1..51 | 2..52 | 272 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:02:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14938-PA | 51 | GM14938-PA | 1..51 | 2..52 | 248 | 90.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:02:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12342-PA | 51 | GD12342-PA | 1..51 | 2..52 | 232 | 84.3 | Plus |