Clone GH08412 Report

Search the DGRC for GH08412

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:84
Well:12
Vector:pOT2
Associated Gene/TranscriptMet75Ca-RA
Protein status:GH08412.pep: gold
Sequenced Size:317

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Met75Ca 2008-12-18 5.12 accounting

Clone Sequence Records

GH08412.complete Sequence

317 bp assembled on 2008-12-09

GenBank Submission: BT053698.1

> GH08412.complete
ACAAGATGAACGTATTCAATGGTTTCTTGCTAGTCTTCCTGGGCCTGGCC
CTCAGCTCTGTGGATGCACAGATAGCAACACGCCAGGAAACCTCGGAGGA
CAAGGCTTGTGGTCCCCACGCCTACTACAATTACGCCCGGCACACTTGCC
TGCCATTCTAGGAACCTTTCCAAAGTGTCCTATGCCTAAAGAAATAAAAC
GTTAAGGTACTAAATGTACCAGAAATTAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

GH08412.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Ca-RA 242 Met75Ca-RA 16..242 1..227 1135 100 Plus
Met75Cb-RA 241 Met75Cb-RA 16..241 1..226 1130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18461723..18461949 227..1 1135 100 Minus
chr3L 24539361 chr3L 18458958..18459183 226..1 1130 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18472141..18472369 229..1 1145 100 Minus
3L 28110227 3L 18469378..18469603 226..1 1130 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18465241..18465469 229..1 1145 100 Minus
3L 28103327 3L 18462478..18462703 226..1 1130 100 Minus
Blast to na_te.dros performed 2019-03-15 21:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 486..514 173..201 100 82.8 Plus

GH08412.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:07:03 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18461723..18461949 1..227 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:53 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 1..156 6..161 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:48 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Cb-RA 1..156 6..161 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:37:59 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 1..156 6..161 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:51 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Cb-RA 1..156 6..161 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 12:05:42 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Cb-RA 1..222 5..226 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:48 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 16..242 1..227 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:37:59 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 16..242 1..227 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:51 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 16..242 1..227 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:03 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18472143..18472369 1..227 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:03 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18472143..18472369 1..227 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:07:03 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18472143..18472369 1..227 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:37:59 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18465243..18465469 1..227 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:27 Download gff for GH08412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18465243..18465469 1..227 100   Minus

GH08412.hyp Sequence

Translation from 1 to 204

> GH08412.hyp
QDERIQWFLASLPGPGPQLCGCTDSNTPGNLGGQGLWSPRLLQLRPAHLP
AILGTFPKCPMPKEIKR*
Sequence GH08412.hyp has no blast hits.

GH08412.pep Sequence

Translation from 2 to 160

> GH08412.pep
KMNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCL
PF*

GH08412.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20134-PA 51 GF20134-PA 1..51 2..52 135 60.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15740-PA 51 GG15740-PA 1..51 2..52 168 80.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Cb-PA 51 CG18064-PA 1..51 2..52 272 100 Plus
Met75Ca-PA 51 CG32197-PA 1..51 2..52 272 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14938-PA 51 GM14938-PA 1..51 2..52 248 90.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12342-PA 51 GD12342-PA 1..51 2..52 232 84.3 Plus