BDGP Sequence Production Resources |
Search the DGRC for GH08457
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 84 |
Well: | 57 |
Vector: | pOT2 |
Associated Gene/Transcript | CG9628-RB |
Protein status: | GH08457.pep: gold |
Sequenced Size: | 878 |
Gene | Date | Evidence |
---|---|---|
CG9628 | 2002-11-11 | Blastp of sequenced clone |
CG9628 | 2008-04-29 | Release 5.5 accounting |
CG9628 | 2008-08-15 | Release 5.9 accounting |
CG9628 | 2008-12-18 | 5.12 accounting |
878 bp (878 high quality bases) assembled on 2002-11-11
GenBank Submission: BT001405
> GH08457.complete TGTCGTCGGTTTCAGAGGTTTTTTGAAAGACGGTTTTTAAAAAACCAATT TCCGCTCTGAGTCGCAGTTTAAACTGAACTACTGAAACTATTTAACGTCG AAAACGTATCCAAATCAGACTCTGCAAAATGAGCTACTTGCGATCGATAG AAATCTCACGCGTCGAAATGTCGCCGGCTGACGATAATTCCTTTGCCACA ACTCATGGAAACAAAAAGGCCACCTACACGGTGATATGCATCAAGATTGT GGAACTGTGCCTGCTTATATGCTGTTTGGGTCTGATCGACGAGCCGGCCA CCAATTCTCATCTGCGGGTGTTCATCACTCCCCGAGTGGCTTCCCTTTGC TATGTGACCTTTGGAGCACTGACCATCTACACGGCAATCTATCTGATAAT GGCGCTCTTCGGTGATTTGACTCCATGGCGTACGGCTACTTTGTGGAATC TAGTGGCCTTTGTGCTCTTCGTGGCCGTAACCGCCCTGCTTTTCCGGGAT TGGTCCACCACCAAGGATCGCAACTACTGGCACCCGAATATGCATCGTTT GGATCTCGTGATGGCTTCCGCCTCGATTGCCTTGGTTACCTCGCTGGTCT TCTTGCTGGACATACTCATCACCCTGCGTTTAGGTGTCCACGGTGATCTA GAATGACATGGTCGATCCCGTGAAGTTTGGCGAGAAAGAGATATACATTC GATTCTCGCCTAGCGTGGACTGTAATATTTATAGCTCCAGCTTAGAAGTA AGAGCCCCGTTCACATACCCGTCTCCCAGCTAATTGTAATCCCACAAGAA AACAAATTGCCATCATCGAATCGAAAATGTACAAAATCGACGTCCGAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9628-RB | 1068 | CG9628-RB | 32..878 | 1..847 | 4235 | 100 | Plus |
CG9628.a | 1033 | CG9628.a | 125..875 | 97..847 | 3755 | 100 | Plus |
CG9628-RC | 874 | CG9628-RC | 125..874 | 97..846 | 3750 | 100 | Plus |
CG9628.a | 1033 | CG9628.a | 1..97 | 1..97 | 485 | 100 | Plus |
CG9628-RC | 874 | CG9628-RC | 1..97 | 1..97 | 485 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 14617627..14618054 | 419..846 | 2140 | 100 | Plus |
chr3L | 24539361 | chr3L | 14617405..14617567 | 257..419 | 815 | 100 | Plus |
chr3L | 24539361 | chr3L | 14617089..14617197 | 149..257 | 545 | 100 | Plus |
chr3L | 24539361 | chr3L | 14612887..14612983 | 1..97 | 485 | 100 | Plus |
chr3L | 24539361 | chr3L | 14616912..14616965 | 97..150 | 270 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 14627556..14627984 | 419..847 | 2145 | 100 | Plus |
3L | 28110227 | 3L | 14627334..14627496 | 257..419 | 815 | 100 | Plus |
3L | 28110227 | 3L | 14627018..14627126 | 149..257 | 545 | 100 | Plus |
3L | 28110227 | 3L | 14622812..14622908 | 1..97 | 485 | 100 | Plus |
3L | 28110227 | 3L | 14626841..14626894 | 97..150 | 270 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 14620656..14621084 | 419..847 | 2145 | 100 | Plus |
3L | 28103327 | 3L | 14620434..14620596 | 257..419 | 815 | 100 | Plus |
3L | 28103327 | 3L | 14620118..14620226 | 149..257 | 545 | 100 | Plus |
3L | 28103327 | 3L | 14615912..14616008 | 1..97 | 485 | 100 | Plus |
3L | 28103327 | 3L | 14619941..14619994 | 97..150 | 270 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
transib4 | 2656 | transib4 TRANSIB4 2656bp | 1981..2031 | 142..191 | 126 | 74.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 14612887..14612982 | 1..96 | 100 | -> | Plus |
chr3L | 14616912..14616965 | 97..150 | 100 | -> | Plus |
chr3L | 14617091..14617197 | 151..257 | 100 | -> | Plus |
chr3L | 14617406..14617566 | 258..418 | 100 | -> | Plus |
chr3L | 14617627..14618054 | 419..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 1..528 | 129..656 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RC | 1..528 | 129..656 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 1..528 | 129..656 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 1..528 | 129..656 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 1..528 | 129..656 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 1..850 | 1..846 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 1..846 | 1..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 17..862 | 1..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 1..850 | 1..846 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9628-RB | 17..862 | 1..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14622812..14622907 | 1..96 | 100 | -> | Plus |
3L | 14626841..14626894 | 97..150 | 100 | -> | Plus |
3L | 14627020..14627126 | 151..257 | 100 | -> | Plus |
3L | 14627335..14627495 | 258..418 | 100 | -> | Plus |
3L | 14627556..14627983 | 419..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14622812..14622907 | 1..96 | 100 | -> | Plus |
3L | 14626841..14626894 | 97..150 | 100 | -> | Plus |
3L | 14627020..14627126 | 151..257 | 100 | -> | Plus |
3L | 14627335..14627495 | 258..418 | 100 | -> | Plus |
3L | 14627556..14627983 | 419..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14622812..14622907 | 1..96 | 100 | -> | Plus |
3L | 14626841..14626894 | 97..150 | 100 | -> | Plus |
3L | 14627020..14627126 | 151..257 | 100 | -> | Plus |
3L | 14627335..14627495 | 258..418 | 100 | -> | Plus |
3L | 14627556..14627983 | 419..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 14615912..14616007 | 1..96 | 100 | -> | Plus |
arm_3L | 14619941..14619994 | 97..150 | 100 | -> | Plus |
arm_3L | 14620120..14620226 | 151..257 | 100 | -> | Plus |
arm_3L | 14620435..14620595 | 258..418 | 100 | -> | Plus |
arm_3L | 14620656..14621083 | 419..846 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14620656..14621083 | 419..846 | 100 | Plus | |
3L | 14615912..14616007 | 1..96 | 100 | -> | Plus |
3L | 14619941..14619994 | 97..150 | 100 | -> | Plus |
3L | 14620120..14620226 | 151..257 | 100 | -> | Plus |
3L | 14620435..14620595 | 258..418 | 100 | -> | Plus |
Translation from 128 to 655
> GH08457.hyp MSYLRSIEISRVEMSPADDNSFATTHGNKKATYTVICIKIVELCLLICCL GLIDEPATNSHLRVFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPW RTATLWNLVAFVLFVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASI ALVTSLVFLLDILITLRLGVHGDLE*
Translation from 128 to 655
> GH08457.pep MSYLRSIEISRVEMSPADDNSFATTHGNKKATYTVICIKIVELCLLICCL GLIDEPATNSHLRVFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPW RTATLWNLVAFVLFVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASI ALVTSLVFLLDILITLRLGVHGDLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24609-PA | 175 | GF24609-PA | 1..175 | 1..175 | 790 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15688-PA | 175 | GG15688-PA | 1..175 | 1..175 | 895 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14752-PA | 175 | GH14752-PA | 1..175 | 1..175 | 766 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9628-PC | 175 | CG9628-PC | 1..175 | 1..175 | 904 | 100 | Plus |
CG9628-PB | 175 | CG9628-PB | 1..175 | 1..175 | 904 | 100 | Plus |
CG9628-PA | 162 | CG9628-PA | 1..162 | 14..175 | 844 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11493-PA | 175 | GI11493-PA | 1..175 | 1..175 | 767 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21019-PA | 175 | GL21019-PA | 1..175 | 1..175 | 788 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21923-PA | 175 | GA21923-PA | 1..175 | 1..175 | 785 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25471-PA | 175 | GM25471-PA | 1..175 | 1..175 | 901 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14494-PA | 175 | GD14494-PA | 1..175 | 1..175 | 902 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13688-PA | 175 | GJ13688-PA | 1..175 | 1..175 | 783 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10529-PA | 175 | GK10529-PA | 1..175 | 1..175 | 748 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22019-PA | 175 | GE22019-PA | 1..175 | 1..175 | 908 | 99.4 | Plus |