Clone GH08457 Report

Search the DGRC for GH08457

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:84
Well:57
Vector:pOT2
Associated Gene/TranscriptCG9628-RB
Protein status:GH08457.pep: gold
Sequenced Size:878

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9628 2002-11-11 Blastp of sequenced clone
CG9628 2008-04-29 Release 5.5 accounting
CG9628 2008-08-15 Release 5.9 accounting
CG9628 2008-12-18 5.12 accounting

Clone Sequence Records

GH08457.complete Sequence

878 bp (878 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001405

> GH08457.complete
TGTCGTCGGTTTCAGAGGTTTTTTGAAAGACGGTTTTTAAAAAACCAATT
TCCGCTCTGAGTCGCAGTTTAAACTGAACTACTGAAACTATTTAACGTCG
AAAACGTATCCAAATCAGACTCTGCAAAATGAGCTACTTGCGATCGATAG
AAATCTCACGCGTCGAAATGTCGCCGGCTGACGATAATTCCTTTGCCACA
ACTCATGGAAACAAAAAGGCCACCTACACGGTGATATGCATCAAGATTGT
GGAACTGTGCCTGCTTATATGCTGTTTGGGTCTGATCGACGAGCCGGCCA
CCAATTCTCATCTGCGGGTGTTCATCACTCCCCGAGTGGCTTCCCTTTGC
TATGTGACCTTTGGAGCACTGACCATCTACACGGCAATCTATCTGATAAT
GGCGCTCTTCGGTGATTTGACTCCATGGCGTACGGCTACTTTGTGGAATC
TAGTGGCCTTTGTGCTCTTCGTGGCCGTAACCGCCCTGCTTTTCCGGGAT
TGGTCCACCACCAAGGATCGCAACTACTGGCACCCGAATATGCATCGTTT
GGATCTCGTGATGGCTTCCGCCTCGATTGCCTTGGTTACCTCGCTGGTCT
TCTTGCTGGACATACTCATCACCCTGCGTTTAGGTGTCCACGGTGATCTA
GAATGACATGGTCGATCCCGTGAAGTTTGGCGAGAAAGAGATATACATTC
GATTCTCGCCTAGCGTGGACTGTAATATTTATAGCTCCAGCTTAGAAGTA
AGAGCCCCGTTCACATACCCGTCTCCCAGCTAATTGTAATCCCACAAGAA
AACAAATTGCCATCATCGAATCGAAAATGTACAAAATCGACGTCCGAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH08457.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9628-RB 1068 CG9628-RB 32..878 1..847 4235 100 Plus
CG9628.a 1033 CG9628.a 125..875 97..847 3755 100 Plus
CG9628-RC 874 CG9628-RC 125..874 97..846 3750 100 Plus
CG9628.a 1033 CG9628.a 1..97 1..97 485 100 Plus
CG9628-RC 874 CG9628-RC 1..97 1..97 485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14617627..14618054 419..846 2140 100 Plus
chr3L 24539361 chr3L 14617405..14617567 257..419 815 100 Plus
chr3L 24539361 chr3L 14617089..14617197 149..257 545 100 Plus
chr3L 24539361 chr3L 14612887..14612983 1..97 485 100 Plus
chr3L 24539361 chr3L 14616912..14616965 97..150 270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14627556..14627984 419..847 2145 100 Plus
3L 28110227 3L 14627334..14627496 257..419 815 100 Plus
3L 28110227 3L 14627018..14627126 149..257 545 100 Plus
3L 28110227 3L 14622812..14622908 1..97 485 100 Plus
3L 28110227 3L 14626841..14626894 97..150 270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14620656..14621084 419..847 2145 100 Plus
3L 28103327 3L 14620434..14620596 257..419 815 100 Plus
3L 28103327 3L 14620118..14620226 149..257 545 100 Plus
3L 28103327 3L 14615912..14616008 1..97 485 100 Plus
3L 28103327 3L 14619941..14619994 97..150 270 100 Plus
Blast to na_te.dros performed 2019-03-16 06:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
transib4 2656 transib4 TRANSIB4 2656bp 1981..2031 142..191 126 74.5 Plus

GH08457.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:06:27 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14612887..14612982 1..96 100 -> Plus
chr3L 14616912..14616965 97..150 100 -> Plus
chr3L 14617091..14617197 151..257 100 -> Plus
chr3L 14617406..14617566 258..418 100 -> Plus
chr3L 14617627..14618054 419..846 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:27:30 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 1..528 129..656 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:06:30 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RC 1..528 129..656 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:02 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 1..528 129..656 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:56:20 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 1..528 129..656 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:12:05 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 1..528 129..656 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:26:10 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 1..850 1..846 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:06:30 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 1..846 1..846 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:02 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 17..862 1..846 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:56:20 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 1..850 1..846 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:12:05 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
CG9628-RB 17..862 1..846 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:27 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14622812..14622907 1..96 100 -> Plus
3L 14626841..14626894 97..150 100 -> Plus
3L 14627020..14627126 151..257 100 -> Plus
3L 14627335..14627495 258..418 100 -> Plus
3L 14627556..14627983 419..846 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:27 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14622812..14622907 1..96 100 -> Plus
3L 14626841..14626894 97..150 100 -> Plus
3L 14627020..14627126 151..257 100 -> Plus
3L 14627335..14627495 258..418 100 -> Plus
3L 14627556..14627983 419..846 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:27 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14622812..14622907 1..96 100 -> Plus
3L 14626841..14626894 97..150 100 -> Plus
3L 14627020..14627126 151..257 100 -> Plus
3L 14627335..14627495 258..418 100 -> Plus
3L 14627556..14627983 419..846 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:02 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14615912..14616007 1..96 100 -> Plus
arm_3L 14619941..14619994 97..150 100 -> Plus
arm_3L 14620120..14620226 151..257 100 -> Plus
arm_3L 14620435..14620595 258..418 100 -> Plus
arm_3L 14620656..14621083 419..846 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:28:48 Download gff for GH08457.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14620656..14621083 419..846 100   Plus
3L 14615912..14616007 1..96 100 -> Plus
3L 14619941..14619994 97..150 100 -> Plus
3L 14620120..14620226 151..257 100 -> Plus
3L 14620435..14620595 258..418 100 -> Plus

GH08457.hyp Sequence

Translation from 128 to 655

> GH08457.hyp
MSYLRSIEISRVEMSPADDNSFATTHGNKKATYTVICIKIVELCLLICCL
GLIDEPATNSHLRVFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPW
RTATLWNLVAFVLFVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASI
ALVTSLVFLLDILITLRLGVHGDLE*

GH08457.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9628-PC 175 CG9628-PC 1..175 1..175 904 100 Plus
CG9628-PB 175 CG9628-PB 1..175 1..175 904 100 Plus
CG9628-PA 162 CG9628-PA 1..162 14..175 844 100 Plus

GH08457.pep Sequence

Translation from 128 to 655

> GH08457.pep
MSYLRSIEISRVEMSPADDNSFATTHGNKKATYTVICIKIVELCLLICCL
GLIDEPATNSHLRVFITPRVASLCYVTFGALTIYTAIYLIMALFGDLTPW
RTATLWNLVAFVLFVAVTALLFRDWSTTKDRNYWHPNMHRLDLVMASASI
ALVTSLVFLLDILITLRLGVHGDLE*

GH08457.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24609-PA 175 GF24609-PA 1..175 1..175 790 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15688-PA 175 GG15688-PA 1..175 1..175 895 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14752-PA 175 GH14752-PA 1..175 1..175 766 88 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9628-PC 175 CG9628-PC 1..175 1..175 904 100 Plus
CG9628-PB 175 CG9628-PB 1..175 1..175 904 100 Plus
CG9628-PA 162 CG9628-PA 1..162 14..175 844 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11493-PA 175 GI11493-PA 1..175 1..175 767 87.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21019-PA 175 GL21019-PA 1..175 1..175 788 92.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21923-PA 175 GA21923-PA 1..175 1..175 785 92 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25471-PA 175 GM25471-PA 1..175 1..175 901 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14494-PA 175 GD14494-PA 1..175 1..175 902 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13688-PA 175 GJ13688-PA 1..175 1..175 783 90.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10529-PA 175 GK10529-PA 1..175 1..175 748 85.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22019-PA 175 GE22019-PA 1..175 1..175 908 99.4 Plus