Clone GH08474 Report

Search the DGRC for GH08474

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:84
Well:74
Vector:pOT2
Associated Gene/TranscriptCG11876-RA
Protein status:GH08474.pep: gold
Preliminary Size:1797
Sequenced Size:1464

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11876 2001-01-01 Release 2 assignment
CG11876 2001-07-04 Blastp of sequenced clone
CG11876 2003-01-01 Sim4 clustering to Release 3
CG11876 2008-04-29 Release 5.5 accounting
CG11876 2008-08-15 Release 5.9 accounting
CG11876 2008-12-18 5.12 accounting

Clone Sequence Records

GH08474.complete Sequence

1464 bp (1464 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047573

> GH08474.complete
TAAACCCATAGCCCATTTTTAGTTAGATAATAGCACTTAAAACCCAAAAA
ATAACACCTACAGCCGGCAACGATAGCGATAGACCCATAGGAAAGCGAAC
CGCAAACCGACGATGCTCCGAACCCGACTCATCCAGGCGGCCAGCTCCGC
CCAGCGAGCGTTCTCCACCAGCCAGAAGGCCCTGGCGGCCAAGCAGATGA
CCGTGCGAGATGCCCTCAACAGCGCATTGGACGATGAGCTGGCCCGCGAC
GACCGCGTCTTCATCCTGGGCGAGGAGGTGGCCCAGTACGACGGTGCTTA
CAAGGTTTCCCGTGGACTGTGGAAGAAGTACGGCGACAAGCGCGTCATCG
ACACGCCAATCACAGAGATGGGCTTTGCCGGCATCGCTGTTGGCGCTGCC
ATGGCCGGTCTGCGTCCCGTGTGCGAGTTCATGACCTGGAACTTCTCCAT
GCAGGCCATCGATCACATCATCAACTCGGCGGCCAAGACCTTCTACATGT
CTGCCGGTGCCGTCAATGTGCCCATTGTGTTCCGTGGTCCCAATGGAGCC
GCTTCCGGTGTTGCCGCCCAGCACTCTCAGTGCTTCGCCGCCTGGTACGC
CCACTGCCCCGGCCTGAAGGTCCTTTCGCCATACGATGCCGAGGATGCCC
GCGGACTGTTGAAGTCCGCAATCCGTGATCCCGATCCAGTGGTCTTCCTG
GAGAATGAGCTGGTCTATGGCACGGCATTCCCTGTGGCCGATAACGTGGC
CGACAAGGACTTCTTGGTGCCCATCGGCAAGGCCAAGGTAATGCGGCCGG
GCAAGGACATTACCCTGGTGGCGCATTCCAAGGCGGTGGAGACATCGCTT
CTGGCAGCTGCCGAGCTGGCCAAGAAGGGTATTGAGGCTGAGGTCATTAA
CCTGCGCTCCATTCGTCCTCTGGACACGGCGACCATCTTCGCCTCTGTAC
GAAAGACCCACCATCTGGTGACCGTGGAGAACGGCTGGCCCCAACACGGC
GTTGGAGCTGAGATCTGCGCCCGCATAATGGAGGACCAGACCTTCTTCGA
GCTGGACGCCCCCGTATGGCGCTGCGCCGGCGTGGATGTGCCCATGCCCT
ATGCCAAGACGCTGGAGGCCCACGCCCTGCCCCGCGTTCAGGATCTCGTG
GAGGCGACTCTTAAGGTCTTGGGTGGCAAAGTGGGCAAGGCCGCTGCGGC
CAACAAGTAGGAACTCAGGACTAGCCAGCCTCCCGATCGGAACCCCCAGC
TAACTAAATTTATAGTCCAAGTCGAAACGCTGCCTCTGGTCTAACCGAGC
TGCCCCCATAATAGTGCACCGAACTGGAAATTGAATGTTCTGAAAATAAA
GCACTACCGCTTTCGGGTTTTGATTAGTTTTCGGACGTTCTAGTTTAATT
ATTTGGTTATAGAAATCTCTTGTGAAAAATAAACGAAAACATAAATAAAA
AAAAAAAAAAAAAA

GH08474.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG11876-RD 1527 CG11876-RD 80..1526 1..1447 7235 100 Plus
CG11876-RA 1514 CG11876-RA 116..1500 63..1447 6925 100 Plus
CG11876-RB 1124 CG11876-RB 80..545 1..466 2330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24938644..24939092 998..1446 2245 100 Plus
chr3R 27901430 chr3R 24937991..24938405 467..881 2075 100 Plus
chr3R 27901430 chr3R 24936043..24936348 1..306 1515 99.7 Plus
chr3R 27901430 chr3R 24936889..24937052 303..466 820 100 Plus
chr3R 27901430 chr3R 24938463..24938584 878..999 610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29115747..29116196 998..1447 2250 100 Plus
3R 32079331 3R 29115094..29115508 467..881 2075 100 Plus
3R 32079331 3R 29113146..29113451 1..306 1530 100 Plus
3R 32079331 3R 29113992..29114155 303..466 820 100 Plus
3R 32079331 3R 29115566..29115687 878..999 610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28856578..28857027 998..1447 2250 100 Plus
3R 31820162 3R 28855925..28856339 467..881 2075 100 Plus
3R 31820162 3R 28853977..28854282 1..306 1530 100 Plus
3R 31820162 3R 28854823..28854986 303..466 820 100 Plus
3R 31820162 3R 28856397..28856518 878..999 610 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:59:17 has no hits.

GH08474.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:00:15 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24936043..24936346 1..304 99 -> Plus
chr3R 24936891..24937052 305..466 100 -> Plus
chr3R 24937991..24938402 467..878 100 -> Plus
chr3R 24938464..24938583 879..998 100 -> Plus
chr3R 24938645..24939092 999..1446 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:27:37 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RD 1..1098 113..1210 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:28:54 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RD 1..1098 113..1210 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:00:34 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RA 1..1098 113..1210 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:19 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RD 1..1098 113..1210 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:18:44 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RA 1..1098 113..1210 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:29:06 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RD 42..1487 1..1446 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:28:54 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RD 42..1487 1..1446 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:00:34 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RA 70..1453 63..1446 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:19 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RD 42..1487 1..1446 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:18:44 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RA 70..1453 63..1446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:15 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29113146..29113449 1..304 100 -> Plus
3R 29113994..29114155 305..466 100 -> Plus
3R 29115094..29115505 467..878 100 -> Plus
3R 29115567..29115686 879..998 100 -> Plus
3R 29115748..29116195 999..1446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:15 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29113146..29113449 1..304 100 -> Plus
3R 29113994..29114155 305..466 100 -> Plus
3R 29115094..29115505 467..878 100 -> Plus
3R 29115567..29115686 879..998 100 -> Plus
3R 29115748..29116195 999..1446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:15 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29113146..29113449 1..304 100 -> Plus
3R 29113994..29114155 305..466 100 -> Plus
3R 29115094..29115505 467..878 100 -> Plus
3R 29115567..29115686 879..998 100 -> Plus
3R 29115748..29116195 999..1446 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:00:34 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24938868..24939171 1..304 100 -> Plus
arm_3R 24939716..24939877 305..466 100 -> Plus
arm_3R 24940816..24941227 467..878 100 -> Plus
arm_3R 24941289..24941408 879..998 100 -> Plus
arm_3R 24941470..24941917 999..1446 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:40:15 Download gff for GH08474.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28855925..28856336 467..878 100 -> Plus
3R 28853977..28854280 1..304 100 -> Plus
3R 28854825..28854986 305..466 100 -> Plus
3R 28856398..28856517 879..998 100 -> Plus
3R 28856579..28857026 999..1446 100   Plus

GH08474.hyp Sequence

Translation from 112 to 1209

> GH08474.hyp
MLRTRLIQAASSAQRAFSTSQKALAAKQMTVRDALNSALDDELARDDRVF
ILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGFAGIAVGAAMAGL
RPVCEFMTWNFSMQAIDHIINSAAKTFYMSAGAVNVPIVFRGPNGAASGV
AAQHSQCFAAWYAHCPGLKVLSPYDAEDARGLLKSAIRDPDPVVFLENEL
VYGTAFPVADNVADKDFLVPIGKAKVMRPGKDITLVAHSKAVETSLLAAA
ELAKKGIEAEVINLRSIRPLDTATIFASVRKTHHLVTVENGWPQHGVGAE
ICARIMEDQTFFELDAPVWRCAGVDVPMPYAKTLEAHALPRVQDLVEATL
KVLGGKVGKAAAANK*

GH08474.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG11876-PD 365 CG11876-PD 1..365 1..365 1866 100 Plus
CG11876-PA 365 CG11876-PA 1..365 1..365 1866 100 Plus
CG11876-PB 273 CG11876-PB 1..118 1..118 596 100 Plus
CG11876-PC 273 CG11876-PC 1..118 1..118 596 100 Plus
CG17691-PE 364 CG17691-PE 41..341 27..330 468 36.8 Plus

GH08474.pep Sequence

Translation from 112 to 1209

> GH08474.pep
MLRTRLIQAASSAQRAFSTSQKALAAKQMTVRDALNSALDDELARDDRVF
ILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGFAGIAVGAAMAGL
RPVCEFMTWNFSMQAIDHIINSAAKTFYMSAGAVNVPIVFRGPNGAASGV
AAQHSQCFAAWYAHCPGLKVLSPYDAEDARGLLKSAIRDPDPVVFLENEL
VYGTAFPVADNVADKDFLVPIGKAKVMRPGKDITLVAHSKAVETSLLAAA
ELAKKGIEAEVINLRSIRPLDTATIFASVRKTHHLVTVENGWPQHGVGAE
ICARIMEDQTFFELDAPVWRCAGVDVPMPYAKTLEAHALPRVQDLVEATL
KVLGGKVGKAAAANK*

GH08474.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23287-PA 509 GF23287-PA 263..497 119..353 1200 93.6 Plus
Dana\GF23287-PA 509 GF23287-PA 1..118 1..118 533 89.8 Plus
Dana\GF15686-PA 505 GF15686-PA 181..504 26..354 497 36.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11642-PA 365 GG11642-PA 1..365 1..365 1901 97.3 Plus
Dere\GG23089-PA 361 GG23089-PA 37..338 26..330 476 36.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19645-PA 360 GH19645-PA 1..359 1..359 1687 86.1 Plus
Dgri\GH13348-PA 322 GH13348-PA 1..307 29..340 490 38.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Pdhb-PD 365 CG11876-PD 1..365 1..365 1866 100 Plus
Pdhb-PA 365 CG11876-PA 1..365 1..365 1866 100 Plus
Pdhb-PB 273 CG11876-PB 1..118 1..118 596 100 Plus
Pdhb-PC 273 CG11876-PC 1..118 1..118 596 100 Plus
CG17691-PE 364 CG17691-PE 41..341 27..330 468 36.8 Plus
CG17691-PC 364 CG17691-PC 41..341 27..330 468 36.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22271-PA 356 GI22271-PA 1..356 1..356 1684 86.8 Plus
Dmoj\GI18255-PA 364 GI18255-PA 16..349 7..340 485 35.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23909-PA 365 GL23909-PA 1..365 1..365 1746 89.9 Plus
Dper\GL21161-PA 347 GL21161-PA 14..332 17..340 507 37.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11252-PA 365 GA11252-PA 1..365 1..365 1745 89.9 Plus
Dpse\GA11252-PB 275 GA11252-PB 1..118 1..118 568 89 Plus
Dpse\GA29202-PA 347 GA29202-PA 14..332 17..340 507 37.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12765-PA 365 GM12765-PA 1..365 1..365 1936 99.7 Plus
Dsec\GM10081-PA 364 GM10081-PA 40..341 26..330 484 37 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21413-PA 448 GD21413-PA 195..448 112..365 1330 97.6 Plus
Dsim\GD21413-PA 448 GD21413-PA 1..118 1..118 625 100 Plus
Dsim\GD17911-PA 159 GD17911-PA 1..145 88..234 225 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24064-PA 360 GJ24064-PA 1..359 1..359 1715 87.2 Plus
Dvir\GJ17514-PA 364 GJ17514-PA 17..349 8..340 490 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11887-PA 512 GK11887-PA 266..500 119..353 1162 90.2 Plus
Dwil\GK11887-PA 512 GK11887-PA 1..119 1..118 551 88.2 Plus
Dwil\GK23412-PA 361 GK23412-PA 38..359 27..353 491 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23833-PA 365 GE23833-PA 1..365 1..365 1894 97 Plus
Dyak\GE15211-PA 363 GE15211-PA 17..340 5..330 484 35.5 Plus