Clone GH08548 Report

Search the DGRC for GH08548

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:85
Well:48
Vector:pOT2
Associated Gene/TranscriptCG3321-RA
Protein status:GH08548.pep: gold
Preliminary Size:1300
Sequenced Size:559

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3321 2001-01-01 Release 2 assignment
CG3321 2003-01-01 Sim4 clustering to Release 3
CG3321 2003-03-19 Blastp of sequenced clone
CG3321 2008-04-29 Release 5.5 accounting
CG3321 2008-08-15 Release 5.9 accounting
CG3321 2008-12-18 5.12 accounting

Clone Sequence Records

GH08548.complete Sequence

559 bp (559 high quality bases) assembled on 2003-03-19

GenBank Submission: AY060656

> GH08548.complete
CTGTTTTAAGGTTATACTGCGCTGCCGTTGCAATCGCTCCACCAATTTGT
TCACGGTCGGACAATTACATAACTTGAAGAAGAAACCATGTCGCAGGCTC
CCGTTCGCGTTTCCCCGCTGATCAAGTTCGGCAGATGGTCCCTGCTCCTG
GTGGGCATTGCCTACGGCGCCGCCCACCAGAGCCGCCTGTCCAAGAAGGA
GGAGAAGTTGCGCGAGATCGAGGCACAGCAGAAGGCCGTCCGTGATGCCA
AGCTCGCCGAGGAGAAGAAGCGCAGCGCAGAGGCTGAGGCCCGTGCCTTG
GCTGAGCTTTCGAAGCCCACTCCCAAGCACTAGGATCCTTCAGGATGCAA
CATCCGCAGTTCCCTTAGCTTAAAAACATTGAAAAACCACAACATTTACA
CACGAAGTTCGCCCAAAAGGAGGAGCATCATCGATAGTGGAGCCACCATC
TATCGATCACTGACTATCGTTTTTGTGTTTTCCTCTGATGCTTGTGCAAA
AAACAGAATGTTCGAAATTAAATGATTGAAACAAAAAAAAAAAAAAAAAA
AAAAAAAAA

GH08548.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG3321-RA 937 CG3321-RA 200..735 1..536 2680 100 Plus
CG3321.b 664 CG3321.b 166..652 50..536 2435 100 Plus
CG3321-RB 993 CG3321-RB 305..791 50..536 2435 100 Plus
CG3321.b 664 CG3321.b 56..104 1..49 245 100 Plus
CG3321-RB 993 CG3321-RB 200..248 1..49 245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10152068..10152551 49..532 2390 99.6 Plus
chr3R 27901430 chr3R 10151895..10151943 1..49 245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14327252..14327739 49..536 2440 100 Plus
3R 32079331 3R 14327079..14327127 1..49 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14068083..14068570 49..536 2440 100 Plus
3R 31820162 3R 14067910..14067958 1..49 245 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:17:34 has no hits.

GH08548.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:18:41 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10151895..10151943 1..49 100 -> Plus
chr3R 10152069..10152551 50..532 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:27:42 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RB 1..246 88..333 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:18 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RC 1..246 88..333 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:30 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RA 1..246 88..333 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:45 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RB 1..246 88..333 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:42 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RA 1..246 88..333 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:42 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RA 56..587 1..532 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:18 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RC 133..664 1..532 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:30 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RA 12..543 1..532 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:45 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RA 56..587 1..532 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:42 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
CG3321-RA 12..543 1..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:41 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14327079..14327127 1..49 100 -> Plus
3R 14327253..14327735 50..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:41 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14327079..14327127 1..49 100 -> Plus
3R 14327253..14327735 50..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:41 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14327079..14327127 1..49 100 -> Plus
3R 14327253..14327735 50..532 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:30 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10152801..10152849 1..49 100 -> Plus
arm_3R 10152975..10153457 50..532 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:56 Download gff for GH08548.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14068084..14068566 50..532 100   Plus
3R 14067910..14067958 1..49 100 -> Plus

GH08548.pep Sequence

Translation from 87 to 332

> GH08548.pep
MSQAPVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKA
VRDAKLAEEKKRSAEAEARALAELSKPTPKH*

GH08548.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17508-PA 81 GF17508-PA 1..81 1..81 391 97.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16851-PA 81 GG16851-PA 1..81 1..81 323 93.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17479-PA 80 GH17479-PA 1..80 1..80 305 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynE-PC 81 CG3321-PC 1..81 1..81 396 100 Plus
ATPsynE-PB 81 CG3321-PB 1..81 1..81 396 100 Plus
ATPsynE-PA 81 CG3321-PA 1..81 1..81 396 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22806-PA 80 GI22806-PA 1..79 1..79 305 93.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23504-PA 81 GL23504-PA 1..81 1..81 323 93.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17372-PA 81 GA17372-PA 1..81 1..81 323 93.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24162-PA 81 GM24162-PA 1..81 1..81 396 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18958-PA 81 GD18958-PA 1..81 1..81 393 97.5 Plus
Dsim\GD14258-PA 72 GD14258-PA 1..72 1..72 310 88.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22808-PA 80 GJ22808-PA 1..78 1..78 309 94.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10942-PA 79 GK10942-PA 1..78 1..78 373 96.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24232-PA 81 GE24232-PA 1..81 1..81 396 98.8 Plus

GH08548.hyp Sequence

Translation from 87 to 332

> GH08548.hyp
MSQAPVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKA
VRDAKLAEEKKRSAEAEARALAELSKPTPKH*

GH08548.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG3321-PC 81 CG3321-PC 1..81 1..81 396 100 Plus
CG3321-PB 81 CG3321-PB 1..81 1..81 396 100 Plus
CG3321-PA 81 CG3321-PA 1..81 1..81 396 100 Plus