BDGP Sequence Production Resources |
Search the DGRC for GH08635
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 86 |
Well: | 35 |
Vector: | pOT2 |
Associated Gene/Transcript | CG31275-RA |
Protein status: | GH08635.pep: gold |
Preliminary Size: | 704 |
Sequenced Size: | 612 |
Gene | Date | Evidence |
---|---|---|
CG14908 | 2002-01-01 | Sim4 clustering to Release 2 |
CG31275 | 2002-05-18 | Blastp of sequenced clone |
CG31275 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31275 | 2008-04-29 | Release 5.5 accounting |
CG31275 | 2008-08-15 | Release 5.9 accounting |
CG31275 | 2008-12-18 | 5.12 accounting |
612 bp (612 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118756
> GH08635.complete GAAGTCATCTTAATAACAGTCGCAAGCTAAAAAAAAATAGTTAATATCTA CACTTAAAATAATGAATCGCATTCTCGAGAAGGTGATTCACCAGAATGGA ACAATCGTGGATCGCATTCTATCGGAACATACTATTGGGTATGTGGTGTC CGATAACACAGCCAATGCGGTGGCCGAAACATCCTTCGATAACACAAGTG CCCAGGCGATCCTGAAGCACTTACATGGACTCCTGGTGAGCACCTGCCAA AGCGTAGTCCGGGACATTGACCCGTCCAACAAACTCTGCTTCATGCGCCT GGGCACTCGCAAGTTCGAGTATCTGGTGGCCCCAGAGGAGTACTTCACCA TTACAGTGGTTCAATGAAATGACAATACTGACTAATGCTACAAACGATTC ATGCGAGTTGAACGATTCCGGAAGAAATACAAAGTTATTGCTGCAAAACC TAAAATTAAACTAGAAATTTTAGAAACAATTTCCTACAACTGGGTCAAGT TTTTAGGAAATTGGTTCCTAAAATCTGTAAAATGTAATGTTACGAAGACA GCAGAAAAATATCAAACAAAAATATAAGATGATATTAGCGAATTAAAAAA AAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 12575265..12575858 | 594..1 | 2940 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 16750739..16751334 | 596..1 | 2980 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 16491570..16492165 | 596..1 | 2980 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12575265..12575858 | 1..594 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..306 | 62..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..306 | 62..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RB | 1..306 | 62..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..306 | 62..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..306 | 62..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..594 | 1..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..594 | 1..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RB | 56..649 | 1..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..594 | 1..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31275-RA | 1..594 | 1..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16750741..16751334 | 1..594 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16750741..16751334 | 1..594 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16750741..16751334 | 1..594 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12576463..12577056 | 1..594 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16491572..16492165 | 1..594 | 100 | Minus |
Translation from 61 to 366
> GH08635.hyp MNRILEKVIHQNGTIVDRILSEHTIGYVVSDNTANAVAETSFDNTSAQAI LKHLHGLLVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVV Q*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31275-PA | 101 | CG31275-PA | 1..101 | 1..101 | 513 | 100 | Plus |
robl62A-PB | 104 | CG1014-PB | 7..103 | 3..100 | 243 | 49 | Plus |
robl62A-PA | 104 | CG1014-PA | 7..103 | 3..100 | 243 | 49 | Plus |
Translation from 61 to 366
> GH08635.pep MNRILEKVIHQNGTIVDRILSEHTIGYVVSDNTANAVAETSFDNTSAQAI LKHLHGLLVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVV Q*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17923-PA | 101 | GF17923-PA | 1..101 | 1..101 | 439 | 78.2 | Plus |
Dana\GF24767-PA | 104 | GF24767-PA | 7..103 | 3..100 | 270 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16811-PA | 101 | GG16811-PA | 1..101 | 1..101 | 518 | 97 | Plus |
Dere\GG14793-PA | 104 | GG14793-PA | 7..103 | 3..100 | 250 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19470-PA | 101 | GH19470-PA | 1..101 | 1..101 | 365 | 63.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31275-PA | 101 | CG31275-PA | 1..101 | 1..101 | 513 | 100 | Plus |
robl62A-PB | 104 | CG1014-PB | 7..103 | 3..100 | 243 | 49 | Plus |
robl62A-PA | 104 | CG1014-PA | 7..103 | 3..100 | 243 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24707-PA | 101 | GI24707-PA | 1..101 | 1..101 | 359 | 65.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23003-PA | 101 | GL23003-PA | 1..101 | 1..101 | 447 | 79.2 | Plus |
Dper\GL22509-PA | 104 | GL22509-PA | 7..103 | 3..100 | 272 | 54.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16143-PA | 101 | GA16143-PA | 1..101 | 1..101 | 448 | 79.2 | Plus |
Dpse\GA10103-PA | 104 | GA10103-PA | 7..103 | 3..100 | 267 | 53.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15406-PA | 101 | GM15406-PA | 1..101 | 1..101 | 530 | 99 | Plus |
Dsec\GM14415-PA | 104 | GM14415-PA | 7..103 | 3..100 | 250 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20269-PA | 101 | GD20269-PA | 1..101 | 1..101 | 530 | 99 | Plus |
Dsim\GD13620-PA | 104 | GD13620-PA | 7..103 | 3..100 | 250 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23924-PA | 101 | GJ23924-PA | 1..101 | 1..101 | 374 | 67.3 | Plus |