Clone GH08635 Report

Search the DGRC for GH08635

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:86
Well:35
Vector:pOT2
Associated Gene/TranscriptCG31275-RA
Protein status:GH08635.pep: gold
Preliminary Size:704
Sequenced Size:612

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14908 2002-01-01 Sim4 clustering to Release 2
CG31275 2002-05-18 Blastp of sequenced clone
CG31275 2003-01-01 Sim4 clustering to Release 3
CG31275 2008-04-29 Release 5.5 accounting
CG31275 2008-08-15 Release 5.9 accounting
CG31275 2008-12-18 5.12 accounting

Clone Sequence Records

GH08635.complete Sequence

612 bp (612 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118756

> GH08635.complete
GAAGTCATCTTAATAACAGTCGCAAGCTAAAAAAAAATAGTTAATATCTA
CACTTAAAATAATGAATCGCATTCTCGAGAAGGTGATTCACCAGAATGGA
ACAATCGTGGATCGCATTCTATCGGAACATACTATTGGGTATGTGGTGTC
CGATAACACAGCCAATGCGGTGGCCGAAACATCCTTCGATAACACAAGTG
CCCAGGCGATCCTGAAGCACTTACATGGACTCCTGGTGAGCACCTGCCAA
AGCGTAGTCCGGGACATTGACCCGTCCAACAAACTCTGCTTCATGCGCCT
GGGCACTCGCAAGTTCGAGTATCTGGTGGCCCCAGAGGAGTACTTCACCA
TTACAGTGGTTCAATGAAATGACAATACTGACTAATGCTACAAACGATTC
ATGCGAGTTGAACGATTCCGGAAGAAATACAAAGTTATTGCTGCAAAACC
TAAAATTAAACTAGAAATTTTAGAAACAATTTCCTACAACTGGGTCAAGT
TTTTAGGAAATTGGTTCCTAAAATCTGTAAAATGTAATGTTACGAAGACA
GCAGAAAAATATCAAACAAAAATATAAGATGATATTAGCGAATTAAAAAA
AAAAAAAAAAAA

GH08635.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG31275-RA 603 CG31275-RA 1..596 1..596 2980 100 Plus
CG31275-RB 655 CG31275-RB 56..651 1..596 2980 100 Plus
nc_17261.a 692 nc_17261.a 121..258 1..138 690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12575265..12575858 594..1 2940 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16750739..16751334 596..1 2980 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16491570..16492165 596..1 2980 100 Minus
Blast to na_te.dros performed 2019-03-15 15:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3725..3798 500..574 120 64 Plus
opus 7521 opus OPUS 7521bp 6141..6216 405..480 110 60.5 Plus

GH08635.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:21:39 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12575265..12575858 1..594 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:27:53 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..306 62..367 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:53 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..306 62..367 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:25:13 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RB 1..306 62..367 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:04 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..306 62..367 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:19 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..306 62..367 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:59 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..594 1..594 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:52 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..594 1..594 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:25:13 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RB 56..649 1..594 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:04 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..594 1..594 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:19 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
CG31275-RA 1..594 1..594 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:39 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16750741..16751334 1..594 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:39 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16750741..16751334 1..594 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:39 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16750741..16751334 1..594 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:25:13 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12576463..12577056 1..594 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:50 Download gff for GH08635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16491572..16492165 1..594 100   Minus

GH08635.hyp Sequence

Translation from 61 to 366

> GH08635.hyp
MNRILEKVIHQNGTIVDRILSEHTIGYVVSDNTANAVAETSFDNTSAQAI
LKHLHGLLVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVV
Q*

GH08635.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31275-PA 101 CG31275-PA 1..101 1..101 513 100 Plus
robl62A-PB 104 CG1014-PB 7..103 3..100 243 49 Plus
robl62A-PA 104 CG1014-PA 7..103 3..100 243 49 Plus

GH08635.pep Sequence

Translation from 61 to 366

> GH08635.pep
MNRILEKVIHQNGTIVDRILSEHTIGYVVSDNTANAVAETSFDNTSAQAI
LKHLHGLLVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVV
Q*

GH08635.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17923-PA 101 GF17923-PA 1..101 1..101 439 78.2 Plus
Dana\GF24767-PA 104 GF24767-PA 7..103 3..100 270 51 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16811-PA 101 GG16811-PA 1..101 1..101 518 97 Plus
Dere\GG14793-PA 104 GG14793-PA 7..103 3..100 250 48 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19470-PA 101 GH19470-PA 1..101 1..101 365 63.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG31275-PA 101 CG31275-PA 1..101 1..101 513 100 Plus
robl62A-PB 104 CG1014-PB 7..103 3..100 243 49 Plus
robl62A-PA 104 CG1014-PA 7..103 3..100 243 49 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24707-PA 101 GI24707-PA 1..101 1..101 359 65.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23003-PA 101 GL23003-PA 1..101 1..101 447 79.2 Plus
Dper\GL22509-PA 104 GL22509-PA 7..103 3..100 272 54.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16143-PA 101 GA16143-PA 1..101 1..101 448 79.2 Plus
Dpse\GA10103-PA 104 GA10103-PA 7..103 3..100 267 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15406-PA 101 GM15406-PA 1..101 1..101 530 99 Plus
Dsec\GM14415-PA 104 GM14415-PA 7..103 3..100 250 48 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20269-PA 101 GD20269-PA 1..101 1..101 530 99 Plus
Dsim\GD13620-PA 104 GD13620-PA 7..103 3..100 250 48 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23924-PA 101 GJ23924-PA 1..101 1..101 374 67.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13854-PA 101 GK13854-PA 1..101 1..101 396 70.3 Plus
Dwil\GK16985-PA 152 GK16985-PA 6..84 2..82 216 51.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26128-PA 101 GE26128-PA 1..101 1..101 512 95 Plus
Dyak\GE21156-PA 104 GE21156-PA 7..103 3..100 251 48 Plus