Clone GH08657 Report

Search the DGRC for GH08657

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:86
Well:57
Vector:pOT2
Associated Gene/TranscriptCG13841-RA
Protein status:GH08657.pep: gold
Sequenced Size:836

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13841-RA 2009-01-21 est gleaning
CG13841-RA 2010-01-13 Manual selection by Sue Celniker

Clone Sequence Records

GH08657.complete Sequence

836 bp assembled on 2010-02-11

GenBank Submission: BT120307.1

> GH08657.complete
AAGCAGCTTAAATTAGAATGATCAGAGTTACTACGTGCCTGTTGATGTTC
GTATTCTTTGTTTTGTACATCCATCAAAATCATGCCGACACCAAAGTGCT
TTACGAATTTCACATCAGGGAAGCCAACCAGCAGCGCGATGAAATGGGAG
AGTTCAAGGATACGTCCGAGGAATCTGACGAGGAACCCGAACTGATCATC
ACGGGCAAACGAACCTCTTCGTACGTTTTTCCCGCCAAGGATAACAACTA
TGTGTACGTGGAAACGGCCACCTATGTGGCGGATAACAATGGCTATCATG
TCAAGTACAACATCACCTTGGATACCGTGGAGCTTGACCGTCGCCTCAGC
GGACAAGCACTTAAGACCACCGCTGGTTAGGCGACACATCGAGTATTAAA
CTAGTGACTAAGTCGTAGCTGTAGTCAATACTACATTATTTATTCGAACT
TTAAAGTGACACGTTCTCAAAGCACCATTGCAAATAATAAAAGGAACTTT
GAAAGCGAGTTTGGGGCTAACATTAAGTGGTTCCCAAACGGATGACAGTG
CAGTAAGTTATGGCACTTTGTTTTGGCTTTGTTCCAAAGCTGCCACTTTG
GCATTTTAATTTACGAGTGCGAAATACATACTTAAACTATGATACACGAT
CTACAGATGCGGTCAATTTGTTTTAGAGTAAGTGTTAGTAACAACCCGCA
AATATAAACAGGATTTTAGTCAAATTGAATTTGAGCCAAAACAGTTAATA
CAAATAACCCAGGAAATTGGACTATTATCTTGACCGCAGCTGTGCGCAAA
TATAAGAATGTAAATTCCAAAAAAAAAAAAAAAAAA

GH08657.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13841-RA 741 CG13841-RA 45..741 1..697 3485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18590224..18590929 818..113 3500 99.7 Minus
chr3R 27901430 chr3R 18590997..18591074 112..35 390 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:38:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22766732..22767437 818..113 3530 100 Minus
3R 32079331 3R 22767505..22767582 112..35 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22507563..22508268 818..113 3530 100 Minus
3R 31820162 3R 22508336..22508413 112..35 390 100 Minus
3R 31820162 3R 22508479..22508513 35..1 175 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:29:46 has no hits.

GH08657.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:30:44 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18590224..18590929 113..818 99 <- Minus
chr3R 18590997..18591073 36..112 100 <- Minus
chr3R 18591141..18591175 1..35 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 10:06:13 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 1..363 18..380 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:23:12 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 1..363 18..380 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:03 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 1..363 18..380 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:12:44 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 1..363 18..380 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 10:06:13 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 1..676 1..676 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:23:11 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 18..693 1..676 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:03 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 18..693 1..676 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:12:44 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
CG13841-RA 18..835 1..818 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:44 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22767648..22767682 1..35 100   Minus
3R 22766732..22767437 113..818 100 <- Minus
3R 22767505..22767581 36..112 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:44 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22767648..22767682 1..35 100   Minus
3R 22766732..22767437 113..818 100 <- Minus
3R 22767505..22767581 36..112 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:44 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22767648..22767682 1..35 100   Minus
3R 22766732..22767437 113..818 100 <- Minus
3R 22767505..22767581 36..112 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:03 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18593370..18593404 1..35 100   Minus
arm_3R 18592454..18593159 113..818 100 <- Minus
arm_3R 18593227..18593303 36..112 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:49 Download gff for GH08657.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22507563..22508268 113..818 100 <- Minus
3R 22508336..22508412 36..112 100 <- Minus
3R 22508479..22508513 1..35 100   Minus

GH08657.hyp Sequence

Translation from 17 to 379

> GH08657.hyp
MIRVTTCLLMFVFFVLYIHQNHADTKVLYEFHIREANQQRDEMGEFKDTS
EESDEEPELIITGKRTSSYVFPAKDNNYVYVETATYVADNNGYHVKYNIT
LDTVELDRRLSGQALKTTAG*

GH08657.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13841-PB 120 CG13841-PB 1..120 1..120 625 100 Plus
CG13841-PA 120 CG13841-PA 1..120 1..120 625 100 Plus

GH08657.pep Sequence

Translation from 17 to 379

> GH08657.pep
MIRVTTCLLMFVFFVLYIHQNHADTKVLYEFHIREANQQRDEMGEFKDTS
EESDEEPELIITGKRTSSYVFPAKDNNYVYVETATYVADNNGYHVKYNIT
LDTVELDRRLSGQALKTTAG*

GH08657.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18282-PA 125 GF18282-PA 1..125 1..120 350 56.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12479-PA 120 GG12479-PA 1..120 1..120 588 90.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18300-PA 129 GH18300-PA 4..129 2..120 282 46.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13841-PB 120 CG13841-PB 1..120 1..120 625 100 Plus
CG13841-PA 120 CG13841-PA 1..120 1..120 625 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10775-PA 123 GI10775-PA 17..123 17..120 240 47.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23770-PA 126 GL23770-PA 5..126 7..120 307 52.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12563-PA 147 GA12563-PA 26..147 7..120 306 52.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23610-PA 120 GM23610-PA 1..120 1..120 618 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18420-PA 120 GD18420-PA 1..120 1..120 613 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14374-PA 121 GJ14374-PA 8..121 7..120 291 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19200-PA 115 GK19200-PA 1..113 9..117 285 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24001-PA 120 GE24001-PA 1..120 1..120 519 89.2 Plus