Clone GH08760 Report

Search the DGRC for GH08760

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:87
Well:60
Vector:pOT2
Associated Gene/TranscripteIF6-RA
Protein status:GH08760.pep: gold
Preliminary Size:1072
Sequenced Size:997

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17611 2001-01-01 Release 2 assignment
CG18426 2001-01-01 Release 2 assignment
CG17611 2002-03-19 Blastp of sequenced clone
CG17611 2003-01-01 Sim4 clustering to Release 3
eIF6 2008-04-29 Release 5.5 accounting
eIF6 2008-08-15 Release 5.9 accounting
eIF6 2008-12-18 5.12 accounting

Clone Sequence Records

GH08760.complete Sequence

997 bp (997 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094688

> GH08760.complete
CGAAATTGTGCGAATTTCATCACGACATTTAAATTGATTTCCGGACATAT
AAACAGAATCCAGAACTCATCCGGCAGCAGGCTCAGTCAGGCCAGTAAAT
CCGAAAAGAGAGTAACCAGCAGGAAAAGAGGATCCACGTAAATACAGAGA
AAATGGCTCTACGCGTCCAATTCGAGAACAACGACGACATCGGCGTCTTC
ACTAAACTAACCAACACATACTGCCTGGTGGCCATCGGTGGATCCGAGAC
CTTCTACAGCGCCTTCGAGGCGGAGCTGGGCGACACCATCCCGGTGGTGC
ATGCGAATGTGGGCGGCTGCCGGATCATCGGCCGCCTCACCGTGGGCAAC
CGCAACGGCCTGCTGGTGCCCAACTCCACCACCGACGAGGAGCTGCAACA
CCTGCGTAACAGCCTGCCAGACGCCGTGAAGATTTATCGTGTGGAGGAGC
GCCTGTCCGCGCTGGGCAACGTTATCGCCTGCAATGATTATGTGGCCCTG
GTGCACCCGGATCTGGACAAGGAGACCGAGGAGATCATCGCGGACGTGCT
CAAAGTAGAGGTCTTCCGCCAGACCATTGCCGACAACTCACTGGTGGGCT
CTTACGCCGTGCTGAGCAACCAGGGCGGCATGGTGCATCCCAAGACGAGC
ATTCAGGACCAGGACGAACTGTCGTCCCTGCTGCAGGTTCCCCTCGTGGC
CGGAACAGTGAACCGGGGCAGCGAAGTACTCGCCGCCGGCATGGTCGTCA
ACGACTGGCTCTCCTTCGTGGGCATGAACACCACGGCCACAGAGATCTCC
GTGATCGAGAGCGTCTTCAAGCTTAACCAGGCACAGCCCGCCACAGTGAC
GACCAAGCTGCGTGCGGCCCTCATCGAGGACATGTCCTAAGCGAAACTTT
CCCCACTTTCTACTTGATATAAGGATTATCTGTTATCTTCTACATTTCAT
TTAAGAAATACAAAACACGAAACTAAAACAAAAAAAAAAAAAAAAAA

GH08760.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
eIF6-RA 1054 eIF6-RA 76..1054 1..979 4895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19735328..19736306 979..1 4805 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23849243..23850224 982..1 4910 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23850442..23851423 982..1 4910 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:08:37 has no hits.

GH08760.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:09:26 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19735328..19736306 1..979 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:28:18 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:20 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:41:09 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:38 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:18 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:25 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 76..1054 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:20 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 76..1054 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:41:09 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 78..1056 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:38 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 76..1054 1..979 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:18 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
eIF6-RA 78..1056 1..979 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:26 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23849246..23850224 1..979 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:26 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23849246..23850224 1..979 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:26 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23849246..23850224 1..979 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:41:09 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19736769..19737747 1..979 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:22 Download gff for GH08760.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23850463..23851441 1..979 100   Minus

GH08760.pep Sequence

Translation from 152 to 889

> GH08760.pep
MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVH
ANVGGCRIIGRLTVGNRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEER
LSALGNVIACNDYVALVHPDLDKETEEIIADVLKVEVFRQTIADNSLVGS
YAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAAGMVVN
DWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIEDMS*

GH08760.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24978-PA 245 GH24978-PA 1..245 1..245 1237 94.3 Plus
Dgri\GH22910-PA 205 GH22910-PA 1..205 41..245 1028 94.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
eIF6-PA 245 CG17611-PA 1..245 1..245 1228 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14578-PB 245 GA14578-PB 1..245 1..245 1245 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21479-PA 245 GJ21479-PA 1..245 1..245 1230 94.3 Plus

GH08760.hyp Sequence

Translation from 152 to 889

> GH08760.hyp
MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVH
ANVGGCRIIGRLTVGNRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEER
LSALGNVIACNDYVALVHPDLDKETEEIIADVLKVEVFRQTIADNSLVGS
YAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAAGMVVN
DWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIEDMS*

GH08760.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
eIF6-PA 245 CG17611-PA 1..245 1..245 1228 100 Plus