Clone GH08782 Report

Search the DGRC for GH08782

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:87
Well:82
Vector:pOT2
Associated Gene/TranscriptDer-1-RA
Protein status:GH08782.pep: gold
Preliminary Size:1300
Sequenced Size:1075

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10908 2001-01-01 Release 2 assignment
CG10908 2003-01-01 Sim4 clustering to Release 3
CG10908 2003-03-19 Blastp of sequenced clone
CG10908 2008-04-29 Release 5.5 accounting
CG10908 2008-08-15 Release 5.9 accounting
CG10908 2008-12-18 5.12 accounting

Clone Sequence Records

GH08782.complete Sequence

1075 bp (1075 high quality bases) assembled on 2003-03-19

GenBank Submission: AY069069

> GH08782.complete
AAGCAACAAAAATAGAGAAAATCACTCCGCACAAAAGCAGCGAATTAATG
AATTAAACAGGACACCAAAGCATACACGAGAAGTACACACAATGGACGCT
GGCGTGTGGTACCGCTCGCTGCCCCGCTTCACCCGCTACTGGCTGACGGC
CACCGTGGTGTTGAGCATGCTCTGCCGCTTCGATGTGATACCCCTTCATT
GGCTGCATCTGGACCGATCGGCCGTTTTCAGCAAGCTGCAGCTCTGGCGC
TGCATGACGTCACTGTTCGTCTTTCCCATCTCGTCGAACACGGCCTTCCA
CTTCCTCATCAACTGCTTCTTCATCGTTCAGTACAGCTCCAAACTGGAGA
AGGATCAGTACAGCCGAAGTCCGGCTGATTACCTGTACCTGTTGATCGTG
TCGGCGGTGCTGGCCAACATCGGGGGCATGATCTTCAACGTGTACTTCCT
CATGGACACGCTGGTGCTGGCCATCACGTATATCTGGTGCCAGCTGAACA
AGGACGTCACCGTGAGCTTCTGGTTCGGCACCAGGTTCAAGGCCATGTAC
CTTCCCTGGGTGCTGGCCGCCTTCGAGTTTATTTTCCACTTCTCGCTCGC
CTCGCTGGTGGGCATATTCGTGGGACATGTGTACTACTTCTTCAAGTTCC
AATACTCGCAGGATTTGGGCGGCACACCCCTGTTGGAAACGCCGCAGTTC
TTGAAGCGCCTGGTGCCAGATGTTTCCGGCGGATTCGGCGGCTTCGGACT
CCCACCGGAGAGCAGAGCACCACCTAGGCAGGCGACCGAAAGTCCCTGGG
GCCGGGGCATGACCTTGGGTCGCAACTGAACTCCAAGCTGAAACTCGAAA
CTCTCTAGACTAGACTAATTCCCCTTTTTACGGTTTGGTTTACTCTATTT
TCTCACCAAGCTCTTTACTTTTCCAACTATTTTTCGATCACCACTCGATT
CTCTGGCGACAGCAATAAGTTAACATGTTAAGTGGAAGGATTGCATTGTG
CATTGATGAAATTATATTAAAATATGTGTGTACATAAACAACCATTAAAG
AAGACAAAAAAAAAAAAAAAAAAAA

GH08782.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG10908-RA 1316 CG10908-RA 234..1294 1..1061 5305 100 Plus
CG10908.a 1189 CG10908.a 182..1186 57..1061 5010 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1974830..1975182 703..1055 1705 98.9 Plus
chr2L 23010047 chr2L 1973914..1974249 1..336 1680 100 Plus
chr2L 23010047 chr2L 1974330..1974587 334..591 1275 99.6 Plus
chr2L 23010047 chr2L 1974650..1974761 592..703 560 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1975061..1975419 703..1061 1795 100 Plus
2L 23513712 2L 1974145..1974480 1..336 1680 100 Plus
2L 23513712 2L 1974561..1974818 334..591 1290 100 Plus
2L 23513712 2L 1974881..1974992 592..703 560 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1975061..1975419 703..1061 1795 100 Plus
2L 23513712 2L 1974145..1974480 1..336 1680 100 Plus
2L 23513712 2L 1974561..1974818 334..591 1290 100 Plus
2L 23513712 2L 1974881..1974992 592..703 560 100 Plus
Blast to na_te.dros performed 2019-03-16 00:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT4 1447 Dbuz\BuT4 BUT4 1447bp 1345..1413 974..1041 117 65.2 Plus

GH08782.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:44:11 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1974830..1975182 703..1055 98   Plus
chr2L 1973914..1974249 1..336 100 -> Plus
chr2L 1974333..1974587 337..591 99 -> Plus
chr2L 1974650..1974760 592..702 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:28:26 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
CG10908-RA 1..738 92..829 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:20 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
Der-1-RA 1..738 92..829 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:13 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
Der-1-RA 1..738 92..829 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:46 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
CG10908-RA 1..738 92..829 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:11:57 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
Der-1-RA 1..738 92..829 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:43 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
CG10908-RA 1..1055 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:20 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
Der-1-RA 20..1074 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:13 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
Der-1-RA 34..1088 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:46 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
CG10908-RA 1..1055 1..1055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:11:57 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
Der-1-RA 34..1088 1..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:11 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1974145..1974480 1..336 100 -> Plus
2L 1974564..1974818 337..591 100 -> Plus
2L 1974881..1974991 592..702 100 -> Plus
2L 1975061..1975413 703..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:11 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1974145..1974480 1..336 100 -> Plus
2L 1974564..1974818 337..591 100 -> Plus
2L 1974881..1974991 592..702 100 -> Plus
2L 1975061..1975413 703..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:11 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1974145..1974480 1..336 100 -> Plus
2L 1974564..1974818 337..591 100 -> Plus
2L 1974881..1974991 592..702 100 -> Plus
2L 1975061..1975413 703..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:13 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1974145..1974480 1..336 100 -> Plus
arm_2L 1974564..1974818 337..591 100 -> Plus
arm_2L 1974881..1974991 592..702 100 -> Plus
arm_2L 1975061..1975413 703..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:58 Download gff for GH08782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1974145..1974480 1..336 100 -> Plus
2L 1974564..1974818 337..591 100 -> Plus
2L 1974881..1974991 592..702 100 -> Plus
2L 1975061..1975413 703..1055 100   Plus

GH08782.hyp Sequence

Translation from 1 to 828

> GH08782.hyp
SNKNRENHSAQKQRINELNRTPKHTREVHTMDAGVWYRSLPRFTRYWLTA
TVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFH
FLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFL
MDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFSLA
SLVGIFVGHVYYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGL
PPESRAPPRQATESPWGRGMTLGRN*

GH08782.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Der-1-PB 245 CG10908-PB 1..245 31..275 1316 100 Plus
Der-1-PA 245 CG10908-PA 1..245 31..275 1316 100 Plus
Der-2-PA 261 CG14899-PA 7..248 36..263 268 29.4 Plus

GH08782.pep Sequence

Translation from 91 to 828

> GH08782.pep
MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQ
LWRCMTSLFVFPISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYL
LIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQLNKDVTVSFWFGTRFK
AMYLPWVLAAFEFIFHFSLASLVGIFVGHVYYFFKFQYSQDLGGTPLLET
PQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESPWGRGMTLGRN*

GH08782.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14591-PA 245 GF14591-PA 1..245 1..245 1128 87.8 Plus
Dana\GF16510-PA 257 GF16510-PA 7..257 6..230 252 28.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24816-PA 245 GG24816-PA 1..245 1..245 1253 96.3 Plus
Dere\GG19906-PA 261 GG19906-PA 7..248 6..233 257 29.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25208-PA 246 GH25208-PA 1..246 1..245 1017 74 Plus
Dgri\GH19287-PA 259 GH19287-PA 7..243 6..233 257 29.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
Der-1-PB 245 CG10908-PB 1..245 1..245 1316 100 Plus
Der-1-PA 245 CG10908-PA 1..245 1..245 1316 100 Plus
Der-2-PA 261 CG14899-PA 7..248 6..233 268 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17281-PA 245 GI17281-PA 1..245 1..245 1026 74.3 Plus
Dmoj\GI23500-PA 259 GI23500-PA 7..245 6..233 264 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19666-PA 243 GL19666-PA 1..243 1..245 935 78.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10631-PA 243 GA10631-PA 1..243 1..245 930 78 Plus
Dpse\GA26359-PA 258 GA26359-PA 7..206 6..207 244 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16838-PA 82 GM16838-PA 1..81 1..81 425 98.8 Plus
Dsec\GM15426-PA 261 GM15426-PA 7..248 6..233 255 29.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23120-PA 245 GD23120-PA 1..245 1..245 1272 98.4 Plus
Dsim\GD20283-PA 324 GD20283-PA 7..259 6..244 253 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22875-PA 246 GJ22875-PA 1..246 1..245 1013 74 Plus
Dvir\GJ10254-PA 256 GJ10254-PA 7..247 6..234 262 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24195-PA 247 GK24195-PA 3..247 2..245 1032 75.9 Plus
Dwil\GK11211-PA 259 GK11211-PA 7..251 6..235 250 27.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17801-PA 245 GE17801-PA 1..245 1..245 1258 96.7 Plus
Dyak\GE26308-PA 261 GE26308-PA 7..248 6..233 257 29.4 Plus