Clone GH08867 Report

Search the DGRC for GH08867

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:88
Well:67
Vector:pOT2
Associated Gene/TranscriptninaA-RA
Protein status:GH08867.pep: gold
Preliminary Size:967
Sequenced Size:849

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3966 2001-01-01 Release 2 assignment
CG3966 2002-06-01 Blastp of sequenced clone
CG3966 2003-01-01 Sim4 clustering to Release 3
ninaA 2008-04-29 Release 5.5 accounting
ninaA 2008-08-15 Release 5.9 accounting
ninaA 2008-12-18 5.12 accounting

Clone Sequence Records

GH08867.complete Sequence

849 bp (849 high quality bases) assembled on 2002-06-01

GenBank Submission: AY119494

> GH08867.complete
CGCGTTAGGTCCGTAAAATCATGAAGTCATTGCTCAATCGGATAATCCTG
TGCAGCGCCTTTCTGGCCGTGGCCAGTGGTCTGAGCTTCACGGTCACGTC
TCGGATCTACATGGATGTGAAGCACAACAAGAAGCCGGTGGGCAGGATCA
CGTTTGGACTGTTCGGGAAGCTGGCTCCCAAGACGGTGGCCAACTTCCGG
CACATTTGCTTGCGCGGCATCAACGGGACCAGCTACGTGGGCTCGCGATT
CCATCGCGTGGTGGACCGCTTTCTCGTCCAAGGCGGCGACATTGTGAACG
GCGACGGAACTGGCTCCATTAGCATCTATGGGGACTACTTTCCGGACGAG
GATAAGGCTCTGGCGGTGGAGCACAACAGACCCGGTTACTTGGGCATGGC
CAATCGGGGCCCGGACACCAATGGCTGCCAGTTTTATGTGACCACCGTGG
GCGCCAAGTGGCTGGACGGAAAGCACACCGTTTTCGGCAAGGTGCTGGAG
GGAATGGACACCATCTATGCCATTGAGGATGTAAAAACCGATACGGATGA
CTTCCCCGTGGAACCCGTGGTGATCTCCAACTGCGGCGAGATACCCACGG
AGCAGTTCGAGTTCTACCCGGACGACTTCAACATCCTCGGATGGATCAAG
GCGGCTGGTCTGCCCGTGACCAGCTCCTTCTGCGTTCTGCTCATTTTCCA
CTACTTCTTCCGCCAGCTCAACATGTACTGCTGAGGACTTTGGAGTATAA
GCTTTATTACTGCACATAAGACTAAGAAGCCCCCATACACTCCGAATGGA
ATGAAACCCACAATAAATGCATACAAATCTTAAAAAAAAAAAAAAAAAA

GH08867.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
ninaA-RA 994 ninaA-RA 135..967 1..833 4165 100 Plus
CG15824-RA 6095 CG15824-RA 5998..6095 833..736 490 100 Minus
CG15824.a 6145 CG15824.a 6054..6145 833..742 460 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 877251..877782 1..532 2585 99.1 Plus
chr2L 23010047 chr2L 877851..878143 531..831 1275 95.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 877342..877873 1..532 2660 100 Plus
2L 23513712 2L 877970..878272 531..833 1515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 877342..877873 1..532 2660 100 Plus
2L 23513712 2L 877970..878272 531..833 1515 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:25:11 has no hits.

GH08867.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:26:22 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 877251..877780 1..530 99 -> Plus
chr2L 877851..878143 531..831 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:28:49 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 1..714 21..734 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:33:20 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 1..714 21..734 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:55:33 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 1..714 21..734 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:24:58 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 1..714 21..734 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:58:16 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 1..714 21..734 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:04:10 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 50..880 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:33:19 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 50..880 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:55:33 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 41..871 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:24:58 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 50..880 1..831 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:58:16 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
ninaA-RA 41..871 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:22 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
2L 877342..877871 1..530 100 -> Plus
2L 877970..878270 531..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:22 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
2L 877342..877871 1..530 100 -> Plus
2L 877970..878270 531..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:22 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
2L 877342..877871 1..530 100 -> Plus
2L 877970..878270 531..831 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:55:33 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 877342..877871 1..530 100 -> Plus
arm_2L 877970..878270 531..831 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:57:22 Download gff for GH08867.complete
Subject Subject Range Query Range Percent Splice Strand
2L 877342..877871 1..530 100 -> Plus
2L 877970..878270 531..831 100   Plus

GH08867.hyp Sequence

Translation from 20 to 733

> GH08867.hyp
MKSLLNRIILCSAFLAVASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGK
LAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSI
SIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDG
KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFEFYP
DDFNILGWIKAAGLPVTSSFCVLLIFHYFFRQLNMYC*

GH08867.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
ninaA-PA 237 CG3966-PA 1..237 1..237 1269 100 Plus
CG2852-PD 205 CG2852-PD 27..194 25..195 446 49.1 Plus
CG2852-PA 205 CG2852-PA 27..194 25..195 446 49.1 Plus
CG17266-PB 183 CG17266-PB 19..183 29..191 375 44.3 Plus
CG17266-PA 183 CG17266-PA 19..183 29..191 375 44.3 Plus

GH08867.pep Sequence

Translation from 20 to 733

> GH08867.pep
MKSLLNRIILCSAFLAVASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGK
LAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSI
SIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDG
KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFEFYP
DDFNILGWIKAAGLPVTSSFCVLLIFHYFFRQLNMYC*

GH08867.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15071-PA 235 GF15071-PA 3..235 5..237 1146 91 Plus
Dana\GF13003-PA 205 GF13003-PA 2..190 7..191 429 43.8 Plus
Dana\GF13802-PA 183 GF13802-PA 7..183 17..191 379 42.2 Plus
Dana\GF18880-PA 946 GF18880-PA 14..182 28..191 365 43.3 Plus
Dana\GF19040-PA 155 GF19040-PA 6..155 38..191 337 44.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24755-PA 236 GG24755-PA 2..236 3..237 1239 98.3 Plus
Dere\GG21776-PA 205 GG21776-PA 27..194 25..195 446 47.4 Plus
Dere\GG10814-PA 183 GG10814-PA 7..183 17..191 377 42.2 Plus
Dere\GG11596-PA 955 GG11596-PA 13..182 27..191 371 44.8 Plus
Dere\GG19332-PA 227 GG19332-PA 68..227 28..191 362 42.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22542-PA 236 GH22542-PA 7..236 8..237 1024 83.9 Plus
Dgri\GH11251-PA 236 GH11251-PA 7..236 8..237 1014 83 Plus
Dgri\GH20332-PA 205 GH20332-PA 4..194 7..195 432 44.4 Plus
Dgri\GH20149-PA 183 GH20149-PA 7..183 17..191 381 42.8 Plus
Dgri\GH17842-PA 165 GH17842-PA 6..165 28..191 372 43.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
ninaA-PA 237 CG3966-PA 1..237 1..237 1269 100 Plus
CG2852-PD 205 CG2852-PD 27..194 25..195 446 49.1 Plus
CG2852-PA 205 CG2852-PA 27..194 25..195 446 49.1 Plus
CG17266-PB 183 CG17266-PB 19..183 29..191 375 44.3 Plus
CG17266-PA 183 CG17266-PA 19..183 29..191 375 44.3 Plus
CG7768-PB 164 CG7768-PB 5..164 28..191 358 45.1 Plus
CG7768-PA 164 CG7768-PA 5..164 28..191 358 45.1 Plus
Cyp1-PA 227 CG9916-PA 68..227 28..191 355 43.3 Plus
Moca-cyp-PA 970 CG1866-PA 14..182 28..191 340 43 Plus
cyp33-PA 300 CG4886-PA 140..299 28..191 322 40.9 Plus
Cypl-PA 176 CG13892-PA 29..168 40..185 311 45.9 Plus
CG8336-PD 383 CG8336-PD 17..208 29..203 293 35.9 Plus
CG8336-PC 383 CG8336-PC 17..208 29..203 293 35.9 Plus
CG8336-PA 383 CG8336-PA 17..208 29..203 293 35.9 Plus
CG8336-PB 383 CG8336-PB 17..208 29..203 293 35.9 Plus
CG3511-PB 637 CG3511-PB 475..637 24..187 285 44.4 Plus
CG3511-PA 637 CG3511-PA 475..637 24..187 285 44.4 Plus
CG7747-PA 517 CG7747-PA 288..429 40..187 284 41.2 Plus
CG10907-PA 502 CG10907-PA 18..156 37..180 246 42.9 Plus
CG11777-PA 161 CG11777-PA 9..141 40..178 194 34.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21863-PA 236 GI21863-PA 2..236 3..237 1086 83.8 Plus
Dmoj\moj29-PA 205 GI20003-PA 27..194 25..195 431 48.5 Plus
Dmoj\GI20240-PA 183 GI20240-PA 7..183 17..191 380 42.8 Plus
Dmoj\GI13698-PA 165 GI13698-PA 6..165 28..191 371 45.1 Plus
Dmoj\GI21755-PA 165 GI21755-PA 6..165 28..191 370 44.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16395-PA 236 GL16395-PA 2..236 3..237 1154 90.6 Plus
Dper\GL17482-PA 205 GL17482-PA 27..194 25..195 438 48 Plus
Dper\GL23654-PA 939 GL23654-PA 14..182 28..191 387 45 Plus
Dper\GL10991-PA 183 GL10991-PA 7..183 17..191 376 42.2 Plus
Dper\GL11464-PA 302 GL11464-PA 142..301 28..191 328 40.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17809-PA 236 GA17809-PA 8..236 9..237 1150 92.6 Plus
Dpse\GA15486-PA 205 GA15486-PA 27..194 25..195 438 48 Plus
Dpse\GA15038-PA 930 GA15038-PA 14..182 28..191 382 44.4 Plus
Dpse\GA14426-PA 183 GA14426-PA 7..183 17..191 376 42.2 Plus
Dpse\Cyp1-PA 226 GA22120-PA 67..226 28..191 356 42.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16777-PA 237 GM16777-PA 1..237 1..237 1255 99.2 Plus
Dsec\GM15627-PA 205 GM15627-PA 27..202 25..202 451 48 Plus
Dsec\GM20863-PA 183 GM20863-PA 7..183 17..191 376 42.2 Plus
Dsec\GM13410-PA 227 GM13410-PA 68..227 28..191 363 42.7 Plus
Dsec\GM25460-PA 164 GM25460-PA 5..164 28..191 357 44.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25116-PA 203 GD25116-PA 25..200 25..202 451 48 Plus
Dsim\GD10314-PA 183 GD10314-PA 7..183 17..191 376 42.2 Plus
Dsim\GD12008-PA 79 GD12008-PA 13..79 171..237 366 100 Plus
Dsim\GD21371-PA 1003 GD21371-PA 14..182 28..191 358 43.9 Plus
Dsim\GD20227-PA 155 GD20227-PA 4..155 36..191 328 42.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17803-PA 236 GJ17803-PA 3..236 4..237 1096 84.2 Plus
Dvir\GJ21252-PA 206 GJ21252-PA 8..195 10..195 430 44.6 Plus
Dvir\GJ20192-PA 183 GJ20192-PA 7..183 17..191 378 42.8 Plus
Dvir\GJ19133-PA 223 GJ19133-PA 54..223 18..191 371 42 Plus
Dvir\GJ14038-PA 164 GJ14038-PA 5..164 28..191 363 43.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24444-PA 238 GK24444-PA 9..238 9..237 1128 91.3 Plus
Dwil\GK21428-PA 204 GK21428-PA 26..193 25..195 429 47.4 Plus
Dwil\GK23148-PA 183 GK23148-PA 7..183 17..191 383 42.8 Plus
Dwil\GK16511-PA 165 GK16511-PA 6..165 28..191 354 43.3 Plus
Dwil\GK14585-PA 165 GK14585-PA 1..165 23..191 352 41.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17188-PA 236 GE17188-PA 2..236 3..237 1232 97.9 Plus
Dyak\GE11851-PA 205 GE11851-PA 27..194 25..195 449 48 Plus
Dyak\GE24621-PA 183 GE24621-PA 7..183 17..191 376 42.2 Plus
Dyak\Cyp1-PA 227 GE15979-PA 68..227 28..191 361 42.7 Plus
Dyak\GE22008-PA 180 GE22008-PA 21..180 28..191 357 44.5 Plus