Clone GH08937 Report

Search the DGRC for GH08937

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:89
Well:37
Vector:pOT2
Associated Gene/TranscriptCG5703-RA
Protein status:GH08937.pep: gold
Preliminary Size:1064
Sequenced Size:934

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5703 2001-01-01 Release 2 assignment
CG5703 2003-01-01 Sim4 clustering to Release 3
CG5703 2003-01-15 Blastp of sequenced clone
CG5703 2008-04-29 Release 5.5 accounting
CG5703 2008-08-15 Release 5.9 accounting
CG5703 2008-12-18 5.12 accounting

Clone Sequence Records

GH08937.complete Sequence

934 bp (934 high quality bases) assembled on 2003-01-15

GenBank Submission: AY075322

> GH08937.complete
AAAAAAACTGACAGCAGCCGACGGACTTCACATAACATAAGAGCAAATTT
TCAGCCTTTTCATTATTTTGGAAACGCCAGAATGCTGACAAACTGTGCCT
CCAAAACACTGGCCGCCGTGCGCGCCAACATCCGGGCAATTGCCACCAGC
AGTGCCCGGGCCAGCGACAATCTGTTCGTCCATCGCGACACACCGGAGGA
TAATCCCAACATCCCGTTCGAGTTCACGGCGGAGAACAAGAAGCGCGTGG
AGGCCATACTCAGCATCTATCCGGAGGGGCACAAGCGCGGCGCCATGATC
CCGCTGCTTGATCTGGCACAGCGCCAGTACGGCTGGCTGCCAATCTCTGC
CATGCACAAGGTGGCCGAGATTCTCCAGTTGCCCAATATGCGCGTCTACG
AGGTGGCCACTTTCTATACGATGTTCATGCGCAAGCCCACTGGCAAGTAT
CACATCCAGGTGTGCACCACCACACCATGCTGGCTCCGCGGATCGGACGA
CATCCTGGAGACCTGCAAGAAGCAGCTGGGCATCGGCGTCGGCGACACCA
CCAAGGACAGGAAGTTCACCATCTCGGAGGTCGAGTGCTTGGGCGCCTGT
GTCAATGCGCCAATGGTGGCGATCAACGATGACTACTATGAGGATCTGAC
ATCCAAGGACATGCAGGACATCCTGAACGACCTGAAGGCGGATAAGATAT
CGCCCCCTGGGCCACGCAACGGACGCTTTGCCAGCGAGCCAAAGGGCGAG
CCCACTTCCCTGAGCGAGGAGCCCAAGGGTCCTGGCTTTGGTCTGCAGGC
CGGTCTGTAGAGGATGAGCAAGGAGCAGAACCTATCACTGATTGTCGAAC
GAAAGTTAAATAAATGTTAAGCAACTTATAGAGGTCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH08937.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5703-RA 1188 CG5703-RA 179..1065 1..887 4435 100 Plus
CG5703.a 1114 CG5703.a 319..1086 120..887 3840 100 Plus
CG5703.a 1114 CG5703.a 179..298 1..120 600 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17521914..17522434 120..640 2605 100 Plus
chrX 22417052 chrX 17522588..17522834 640..886 1235 100 Plus
chrX 22417052 chrX 17521666..17521785 1..120 600 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17632589..17633109 120..640 2605 100 Plus
X 23542271 X 17633263..17633510 640..887 1240 100 Plus
X 23542271 X 17632341..17632460 1..120 600 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17640687..17641207 120..640 2605 100 Plus
X 23527363 X 17641361..17641608 640..887 1240 100 Plus
X 23527363 X 17640439..17640558 1..120 600 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:33:03 has no hits.

GH08937.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:33:52 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17521666..17521785 1..120 100 -> Plus
chrX 17521915..17522433 121..639 100 -> Plus
chrX 17522588..17522834 640..886 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:29:10 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 1..729 82..810 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:56 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 1..729 82..810 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:57:21 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 1..729 82..810 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:54 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 1..729 82..810 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:26 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 1..729 82..810 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:28 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 179..1061 1..883 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:56 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 179..1061 1..883 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:57:21 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 179..1064 1..886 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:54 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 179..1061 1..883 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:26 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
CG5703-RA 179..1064 1..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:52 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
X 17632341..17632460 1..120 100 -> Plus
X 17632590..17633108 121..639 100 -> Plus
X 17633263..17633509 640..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:52 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
X 17632341..17632460 1..120 100 -> Plus
X 17632590..17633108 121..639 100 -> Plus
X 17633263..17633509 640..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:52 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
X 17632341..17632460 1..120 100 -> Plus
X 17632590..17633108 121..639 100 -> Plus
X 17633263..17633509 640..886 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:57:21 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17526374..17526493 1..120 100 -> Plus
arm_X 17526623..17527141 121..639 100 -> Plus
arm_X 17527296..17527542 640..886 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:04 Download gff for GH08937.complete
Subject Subject Range Query Range Percent Splice Strand
X 17640688..17641206 121..639 100 -> Plus
X 17641361..17641607 640..886 100   Plus
X 17640439..17640558 1..120 100 -> Plus

GH08937.hyp Sequence

Translation from 1 to 809

> GH08937.hyp
KKTDSSRRTSHNIRANFQPFHYFGNARMLTNCASKTLAAVRANIRAIATS
SARASDNLFVHRDTPEDNPNIPFEFTAENKKRVEAILSIYPEGHKRGAMI
PLLDLAQRQYGWLPISAMHKVAEILQLPNMRVYEVATFYTMFMRKPTGKY
HIQVCTTTPCWLRGSDDILETCKKQLGIGVGDTTKDRKFTISEVECLGAC
VNAPMVAINDDYYEDLTSKDMQDILNDLKADKISPPGPRNGRFASEPKGE
PTSLSEEPKGPGFGLQAGL*

GH08937.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5703-PB 242 CG5703-PB 1..242 28..269 1276 100 Plus
CG5703-PA 242 CG5703-PA 1..242 28..269 1276 100 Plus
CG6485-PA 238 CG6485-PA 32..227 71..266 600 55.6 Plus

GH08937.pep Sequence

Translation from 81 to 809

> GH08937.pep
MLTNCASKTLAAVRANIRAIATSSARASDNLFVHRDTPEDNPNIPFEFTA
ENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQL
PNMRVYEVATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILETCKKQLG
IGVGDTTKDRKFTISEVECLGACVNAPMVAINDDYYEDLTSKDMQDILND
LKADKISPPGPRNGRFASEPKGEPTSLSEEPKGPGFGLQAGL*

GH08937.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22392-PA 242 GF22392-PA 1..242 1..242 1223 92.6 Plus
Dana\GF24324-PA 236 GF24324-PA 27..230 36..239 616 55.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19123-PA 242 GG19123-PA 1..242 1..242 1294 98.8 Plus
Dere\GG15826-PA 238 GG15826-PA 7..227 16..239 608 50.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24933-PA 242 GH24933-PA 1..242 1..242 1210 90.9 Plus
Dgri\GH14917-PA 248 GH14917-PA 45..238 46..239 584 54.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
ND-24-PB 242 CG5703-PB 1..242 1..242 1276 100 Plus
ND-24-PA 242 CG5703-PA 1..242 1..242 1276 100 Plus
ND-24L-PA 238 CG6485-PA 32..227 44..239 600 55.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14890-PA 242 GI14890-PA 1..242 1..242 1235 93 Plus
Dmoj\GI12897-PA 246 GI12897-PA 21..237 17..239 586 49.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20163-PA 264 GL20163-PA 1..239 1..239 1179 88.7 Plus
Dper\GL15498-PA 190 GL15498-PA 41..173 43..175 417 54.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19069-PA 264 GA19069-PA 1..239 1..239 1177 88.7 Plus
Dpse\GA19629-PA 245 GA19629-PA 41..237 43..239 586 53.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13517-PA 242 GM13517-PA 1..242 1..242 1307 100 Plus
Dsec\GM24346-PA 241 GM24346-PA 3..230 8..239 608 50.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15675-PA 242 GD15675-PA 1..242 1..242 1307 100 Plus
Dsim\GD12420-PA 238 GD12420-PA 27..227 39..239 602 54.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15322-PA 129 GJ15322-PA 1..129 114..242 656 93 Plus
Dvir\GJ13038-PA 247 GJ13038-PA 41..237 43..239 594 55.3 Plus
Dvir\GJ15321-PA 71 GJ15321-PA 1..70 1..70 319 82.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25091-PA 242 GK25091-PA 1..242 1..242 1206 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17674-PA 242 GE17674-PA 1..242 1..242 1300 99.2 Plus
Dyak\GE22166-PA 241 GE22166-PA 4..230 10..239 622 51.3 Plus