Clone GH09022 Report

Search the DGRC for GH09022

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:90
Well:22
Vector:pOT2
Associated Gene/TranscriptCG4409-RB
Protein status:GH09022.pep: gold
Sequenced Size:932

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4409 2008-04-29 Release 5.5 accounting
CG4409 2008-04-29 Picked prior to 5.5
CG4409 2008-08-15 Release 5.9 accounting
CG4409 2008-12-18 5.12 accounting

Clone Sequence Records

GH09022.complete Sequence

932 bp assembled on 2007-09-25

GenBank Submission: BT030816

> GH09022.complete
CTCACATCGCCAGTATGAATCGCGGCCAGCTTTTAGTTTTGTGCATTTTT
GCCACTGGAATTTCCCTTTCGATGGGTTTTCCCCAGGACGATCTAATTAA
GCCGGGTAGTGACGAATCGGATGTGAGTGGCATTGGCTTCGTGACGCTCG
ACGGAACGGCCAGCGAAGAGAGTGACGAAAGCGACCAAGGCAACGCGTCC
GATGATTTGATATTTTTGAGTCGCCAAAAGCCAAGTCCGGTCAACAATTC
CGTCGATTTGAGCGCCTTTGTGGCACTGATTCCTCTGCAAGAAGTCCAGT
CCATTGCTGCTCACTATTATCATCATGATGCGGAGTTTCAAAGGTCGTAC
GCCTTTCTCGCCAGCAGCGATTTCGCGGACATCAAGCGGAAAATACTTCA
GCTGCCGGAAGTGCTGGAGTTCACCAACTATCTGGGTAACAATGGACTAG
ATGTCGTCAAGGTGATGCATTCGGTGGCAGGAGTGTTCAAACCGTCCATT
CTGAGCTCCGCAGCGGTCAACGAGCCAACAAAAGTCACAACCACCGAAGA
TGGCAGCTCCGCCGCTGGAGAAGCACAAACTGGCCTCCATGGAATGGTGG
AGAGGGTCCTGGAAATTCTGCCGCAGGACCAACTGTACGCCCTATTCTTC
GACGAGTTTGAGAGCAACAAACAGTTCGCAGCATTTGTCGACAGCATTAG
CAGTCCAAAGTTTGCCAAGATTTTGAGCGGTTTGCAGAACTCAATGCCGT
TGCGAAATCTACTATTTGTCCTGCACAATAACAGTATCTATGTGGAGCGG
ATTGTGGAGTCCGTAAAATCGTATCTATCCATTTCCAGTTTTTAGTTTGC
CTAAGTCTTAGGGGCTTGTTTTAAGCTCGCTGTGGCAAATAAACTGTATG
AATTAGACAAACTTAAAAAAAAAAAAAAAAAA

GH09022.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG4409-RB 1188 CG4409-RB 149..1063 1..915 4575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12330519..12331040 1..522 2580 99.6 Plus
chr2R 21145070 chr2R 12331190..12331405 522..737 1065 99.5 Plus
chr2R 21145070 chr2R 12331949..12332128 735..914 900 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16443236..16443757 1..522 2610 100 Plus
2R 25286936 2R 16443907..16444122 522..737 1080 100 Plus
2R 25286936 2R 16444666..16444846 735..915 905 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16444435..16444956 1..522 2610 100 Plus
2R 25260384 2R 16445106..16445321 522..737 1080 100 Plus
2R 25260384 2R 16445865..16446045 735..915 905 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:38:18 has no hits.

GH09022.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:39:13 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12330519..12331040 1..522 99 -> Plus
chr2R 12331191..12331405 523..737 99 -> Plus
chr2R 12331952..12332128 738..914 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:29:21 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..831 15..845 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:01:48 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..831 15..845 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:08:50 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..831 15..845 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:47:13 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..831 15..845 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:40 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..831 15..845 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:46:16 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:01:48 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:08:50 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 26..939 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:47:13 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:40 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
CG4409-RB 26..939 1..914 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:13 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16443236..16443757 1..522 100 -> Plus
2R 16443908..16444122 523..737 100 -> Plus
2R 16444669..16444845 738..914 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:13 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16443236..16443757 1..522 100 -> Plus
2R 16443908..16444122 523..737 100 -> Plus
2R 16444669..16444845 738..914 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:13 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16443236..16443757 1..522 100 -> Plus
2R 16443908..16444122 523..737 100 -> Plus
2R 16444669..16444845 738..914 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:08:50 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12330741..12331262 1..522 100 -> Plus
arm_2R 12331413..12331627 523..737 100 -> Plus
arm_2R 12332174..12332350 738..914 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:53:43 Download gff for GH09022.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16445107..16445321 523..737 100 -> Plus
2R 16445868..16446044 738..914 100   Plus
2R 16444435..16444956 1..522 100 -> Plus

GH09022.pep Sequence

Translation from 2 to 844

> GH09022.pep
HIASMNRGQLLVLCIFATGISLSMGFPQDDLIKPGSDESDVSGIGFVTLD
GTASEESDESDQGNASDDLIFLSRQKPSPVNNSVDLSAFVALIPLQEVQS
IAAHYYHHDAEFQRSYAFLASSDFADIKRKILQLPEVLEFTNYLGNNGLD
VVKVMHSVAGVFKPSILSSAAVNEPTKVTTTEDGSSAAGEAQTGLHGMVE
RVLEILPQDQLYALFFDEFESNKQFAAFVDSISSPKFAKILSGLQNSMPL
RNLLFVLHNNSIYVERIVESVKSYLSISSF*

GH09022.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13599-PA 299 GF13599-PA 3..249 29..248 614 56.3 Plus
Dana\GF11262-PA 211 GF11262-PA 26..200 85..271 157 23.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20605-PA 190 GG20605-PA 1..176 5..180 820 88.6 Plus
Dere\GG22265-PA 214 GG22265-PA 29..203 85..271 150 23 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21237-PA 658 GH21237-PA 140..306 77..244 322 37.5 Plus
Dgri\GH20644-PA 209 GH20644-PA 27..201 85..271 153 23.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG4409-PB 276 CG4409-PB 1..276 5..280 1379 100 Plus
CG15712-PA 214 CG15712-PA 29..208 85..276 151 23.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20524-PA 313 GI20524-PA 64..281 64..272 254 33.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10739-PA 250 GL10739-PA 3..246 29..245 557 51.4 Plus
Dper\GL11341-PA 215 GL11341-PA 22..202 77..269 158 25.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24464-PA 317 GA24464-PA 18..317 11..280 720 53.1 Plus
Dpse\GA13908-PA 215 GA13908-PA 30..202 85..269 157 25.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21697-PA 292 GM21697-PA 1..244 5..248 1199 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11193-PA 292 GD11193-PA 1..244 5..248 1198 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22374-PA 320 GJ22374-PA 75..320 64..280 570 48 Plus
Dvir\GJ19973-PA 212 GJ19973-PA 27..199 85..269 163 25.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21602-PA 312 GK21602-PA 115..311 74..261 391 43.5 Plus
Dwil\GK21600-PA 206 GK21600-PA 22..201 85..276 174 23.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11792-PA 277 GE11792-PA 1..277 5..280 1269 88.4 Plus
Dyak\GE14058-PA 214 GE14058-PA 29..201 85..269 147 23 Plus

GH09022.hyp Sequence

Translation from 2 to 844

> GH09022.hyp
HIASMNRGQLLVLCIFATGISLSMGFPQDDLIKPGSDESDVSGIGFVTLD
GTASEESDESDQGNASDDLIFLSRQKPSPVNNSVDLSAFVALIPLQEVQS
IAAHYYHHDAEFQRSYAFLASSDFADIKRKILQLPEVLEFTNYLGNNGLD
VVKVMHSVAGVFKPSILSSAAVNEPTKVTTTEDGSSAAGEAQTGLHGMVE
RVLEILPQDQLYALFFDEFESNKQFAAFVDSISSPKFAKILSGLQNSMPL
RNLLFVLHNNSIYVERIVESVKSYLSISSF*

GH09022.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4409-PB 276 CG4409-PB 1..276 5..280 1379 100 Plus
CG15712-PA 214 CG15712-PA 29..208 85..276 151 23.2 Plus