Clone GH09039 Report

Search the DGRC for GH09039

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:90
Well:39
Vector:pOT2
Associated Gene/TranscriptCG18404-RA
Protein status:GH09039.pep: gold
Preliminary Size:757
Sequenced Size:625

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18404 2001-11-29 Blastp of sequenced clone
CG18404 2002-01-01 Sim4 clustering to Release 2
CG18404 2003-01-01 Sim4 clustering to Release 3
CG18404 2008-04-29 Release 5.5 accounting
CG18404 2008-08-15 Release 5.9 accounting
CG18404 2008-12-18 5.12 accounting

Clone Sequence Records

GH09039.complete Sequence

625 bp (625 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069070

> GH09039.complete
AAGCAATAACATGCAGTCTTTTACAATTCTAACCCTTTTCACCATCGTTT
TGATGGTCCAAAATTCAAGAGCTGGAACTCTCAGCATTGGGTCCCTGATG
GGAGATGTGTCCCAAGTGGCTGTTGCTGGGGAGAAGGTCATCCATCAACT
GGAAAACGCTGTGGCCAGCTCTCAATCGGATTTTGTCCAGCCAACCACTT
TGAACATTCTAAGCGACATGGGAAACGCCTTGGGTGATCTGGCTAACGCC
CTTACTAGTTTAAGAGTGGATAACGATTATATGCAACCCGAGGCCACCAA
TCTCTTGGGCAATGTTCTGGGTGGAGTGGGCACTGGTCTTGGAGATTTGG
CTAATGCCATTACCAGTCTTAGTGTTCAGATGACGAACGCACCTCAGGCT
CGCAGTCTTTCGTCCAATGGTGCTTCTATTATAGCCAAAGGAGGAGCCGT
GAGTGCGAAGACTATTGCCGCTGCTGCAGATGCAGCTGCCCCTTATATAA
AGCAGCTAAATGCTGGCCTAGGCGATCTGGCTAATGCCCTCACCAACCTC
TGAAGAACTTTGGAGCAGTTCAATTAACAAATAAATATTCAATCGCGCAA
AGAGCTTAAAAAAAAAAAAAAAAAA

GH09039.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG18404.a 944 CG18404.a 227..834 1..608 3040 100 Plus
CG18404-RA 959 CG18404-RA 227..834 1..608 3040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26075711..26075954 1..244 1175 98.8 Plus
chr3R 27901430 chr3R 26076014..26076121 245..352 480 96.3 Plus
chr3R 27901430 chr3R 26076400..26076486 446..532 435 100 Plus
chr3R 27901430 chr3R 26076550..26076624 533..607 360 98.7 Plus
chr3R 27901430 chr3R 26076189..26076248 353..412 285 98.3 Plus
chr3R 27901430 chr3R 26076301..26076339 408..446 180 97.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30253182..30253425 1..244 1220 100 Plus
3R 32079331 3R 30253485..30253592 245..352 540 100 Plus
3R 32079331 3R 30253873..30253959 446..532 435 100 Plus
3R 32079331 3R 30254023..30254098 533..608 380 100 Plus
3R 32079331 3R 30253660..30253719 353..412 300 100 Plus
3R 32079331 3R 30253774..30253812 408..446 180 97.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29994013..29994256 1..244 1220 100 Plus
3R 31820162 3R 29994316..29994423 245..352 540 100 Plus
3R 31820162 3R 29994704..29994790 446..532 435 100 Plus
3R 31820162 3R 29994854..29994929 533..608 380 100 Plus
3R 31820162 3R 29994491..29994550 353..412 300 100 Plus
3R 31820162 3R 29994605..29994643 408..446 180 97.4 Plus
Blast to na_te.dros performed 2019-03-16 20:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
mdg3 5519 mdg3 DMMDG3 5519bp Derived from X95908 (e990667) (Rel. 49, Last updated, Version 3). 799..845 173..127 108 75 Minus

GH09039.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:20:35 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26076014..26076121 245..352 96 -> Plus
chr3R 26076189..26076248 353..412 98 -> Plus
chr3R 26076306..26076338 413..445 100 -> Plus
chr3R 26076400..26076486 446..532 100 -> Plus
chr3R 26076550..26076624 533..607 98   Plus
chr3R 26075711..26075954 1..244 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:29:26 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..543 11..553 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:39 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..543 11..553 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:29 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..543 11..553 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:39:19 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..543 11..553 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:59:04 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..543 11..553 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:10:30 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:39 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:29 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:39:19 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:59:04 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
CG18404-RA 1..607 1..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:20:35 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30253182..30253425 1..244 100 -> Plus
3R 30253485..30253592 245..352 100 -> Plus
3R 30253660..30253719 353..412 100 -> Plus
3R 30253779..30253811 413..445 100 -> Plus
3R 30253873..30253959 446..532 100 -> Plus
3R 30254023..30254097 533..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:20:35 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30253182..30253425 1..244 100 -> Plus
3R 30253485..30253592 245..352 100 -> Plus
3R 30253660..30253719 353..412 100 -> Plus
3R 30253779..30253811 413..445 100 -> Plus
3R 30253873..30253959 446..532 100 -> Plus
3R 30254023..30254097 533..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:20:35 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30253182..30253425 1..244 100 -> Plus
3R 30253485..30253592 245..352 100 -> Plus
3R 30253660..30253719 353..412 100 -> Plus
3R 30253779..30253811 413..445 100 -> Plus
3R 30253873..30253959 446..532 100 -> Plus
3R 30254023..30254097 533..607 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:29 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26079501..26079533 413..445 100 -> Plus
arm_3R 26079595..26079681 446..532 100 -> Plus
arm_3R 26079745..26079819 533..607 100   Plus
arm_3R 26078904..26079147 1..244 100 -> Plus
arm_3R 26079207..26079314 245..352 100 -> Plus
arm_3R 26079382..26079441 353..412 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:22:27 Download gff for GH09039.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29994491..29994550 353..412 100 -> Plus
3R 29994610..29994642 413..445 100 -> Plus
3R 29994704..29994790 446..532 100 -> Plus
3R 29994854..29994928 533..607 100   Plus
3R 29994013..29994256 1..244 100 -> Plus
3R 29994316..29994423 245..352 100 -> Plus

GH09039.hyp Sequence

Translation from 1 to 552

> GH09039.hyp
SNNMQSFTILTLFTIVLMVQNSRAGTLSIGSLMGDVSQVAVAGEKVIHQL
ENAVASSQSDFVQPTTLNILSDMGNALGDLANALTSLRVDNDYMQPEATN
LLGNVLGGVGTGLGDLANAITSLSVQMTNAPQARSLSSNGASIIAKGGAV
SAKTIAAAADAAAPYIKQLNAGLGDLANALTNL*

GH09039.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG18404-PA 180 CG18404-PA 1..180 4..183 867 100 Plus

GH09039.pep Sequence

Translation from 10 to 552

> GH09039.pep
MQSFTILTLFTIVLMVQNSRAGTLSIGSLMGDVSQVAVAGEKVIHQLENA
VASSQSDFVQPTTLNILSDMGNALGDLANALTSLRVDNDYMQPEATNLLG
NVLGGVGTGLGDLANAITSLSVQMTNAPQARSLSSNGASIIAKGGAVSAK
TIAAAADAAAPYIKQLNAGLGDLANALTNL*

GH09039.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11744-PA 180 GG11744-PA 1..180 1..180 695 87.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19157-PA 177 GH19157-PA 1..177 1..180 466 60.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG18404-PA 180 CG18404-PA 1..180 1..180 867 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23262-PA 182 GI23262-PA 5..182 6..180 412 56.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13451-PA 181 GL13451-PA 4..181 3..180 618 74.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14921-PB 181 GA14921-PB 4..181 3..180 631 74.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12873-PA 180 GM12873-PA 1..180 1..180 731 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21512-PA 180 GD21512-PA 1..180 1..180 757 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10762-PA 181 GJ10762-PA 1..181 1..180 507 57.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14127-PA 242 GK14127-PA 1..184 1..180 462 58.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10870-PA 180 GE10870-PA 1..180 1..180 712 90.6 Plus