BDGP Sequence Production Resources |
Search the DGRC for GH09039
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 90 |
Well: | 39 |
Vector: | pOT2 |
Associated Gene/Transcript | CG18404-RA |
Protein status: | GH09039.pep: gold |
Preliminary Size: | 757 |
Sequenced Size: | 625 |
Gene | Date | Evidence |
---|---|---|
CG18404 | 2001-11-29 | Blastp of sequenced clone |
CG18404 | 2002-01-01 | Sim4 clustering to Release 2 |
CG18404 | 2003-01-01 | Sim4 clustering to Release 3 |
CG18404 | 2008-04-29 | Release 5.5 accounting |
CG18404 | 2008-08-15 | Release 5.9 accounting |
CG18404 | 2008-12-18 | 5.12 accounting |
625 bp (625 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069070
> GH09039.complete AAGCAATAACATGCAGTCTTTTACAATTCTAACCCTTTTCACCATCGTTT TGATGGTCCAAAATTCAAGAGCTGGAACTCTCAGCATTGGGTCCCTGATG GGAGATGTGTCCCAAGTGGCTGTTGCTGGGGAGAAGGTCATCCATCAACT GGAAAACGCTGTGGCCAGCTCTCAATCGGATTTTGTCCAGCCAACCACTT TGAACATTCTAAGCGACATGGGAAACGCCTTGGGTGATCTGGCTAACGCC CTTACTAGTTTAAGAGTGGATAACGATTATATGCAACCCGAGGCCACCAA TCTCTTGGGCAATGTTCTGGGTGGAGTGGGCACTGGTCTTGGAGATTTGG CTAATGCCATTACCAGTCTTAGTGTTCAGATGACGAACGCACCTCAGGCT CGCAGTCTTTCGTCCAATGGTGCTTCTATTATAGCCAAAGGAGGAGCCGT GAGTGCGAAGACTATTGCCGCTGCTGCAGATGCAGCTGCCCCTTATATAA AGCAGCTAAATGCTGGCCTAGGCGATCTGGCTAATGCCCTCACCAACCTC TGAAGAACTTTGGAGCAGTTCAATTAACAAATAAATATTCAATCGCGCAA AGAGCTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 26075711..26075954 | 1..244 | 1175 | 98.8 | Plus |
chr3R | 27901430 | chr3R | 26076014..26076121 | 245..352 | 480 | 96.3 | Plus |
chr3R | 27901430 | chr3R | 26076400..26076486 | 446..532 | 435 | 100 | Plus |
chr3R | 27901430 | chr3R | 26076550..26076624 | 533..607 | 360 | 98.7 | Plus |
chr3R | 27901430 | chr3R | 26076189..26076248 | 353..412 | 285 | 98.3 | Plus |
chr3R | 27901430 | chr3R | 26076301..26076339 | 408..446 | 180 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 30253182..30253425 | 1..244 | 1220 | 100 | Plus |
3R | 32079331 | 3R | 30253485..30253592 | 245..352 | 540 | 100 | Plus |
3R | 32079331 | 3R | 30253873..30253959 | 446..532 | 435 | 100 | Plus |
3R | 32079331 | 3R | 30254023..30254098 | 533..608 | 380 | 100 | Plus |
3R | 32079331 | 3R | 30253660..30253719 | 353..412 | 300 | 100 | Plus |
3R | 32079331 | 3R | 30253774..30253812 | 408..446 | 180 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29994013..29994256 | 1..244 | 1220 | 100 | Plus |
3R | 31820162 | 3R | 29994316..29994423 | 245..352 | 540 | 100 | Plus |
3R | 31820162 | 3R | 29994704..29994790 | 446..532 | 435 | 100 | Plus |
3R | 31820162 | 3R | 29994854..29994929 | 533..608 | 380 | 100 | Plus |
3R | 31820162 | 3R | 29994491..29994550 | 353..412 | 300 | 100 | Plus |
3R | 31820162 | 3R | 29994605..29994643 | 408..446 | 180 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mdg3 | 5519 | mdg3 DMMDG3 5519bp Derived from X95908 (e990667) (Rel. 49, Last updated, Version 3). | 799..845 | 173..127 | 108 | 75 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26076014..26076121 | 245..352 | 96 | -> | Plus |
chr3R | 26076189..26076248 | 353..412 | 98 | -> | Plus |
chr3R | 26076306..26076338 | 413..445 | 100 | -> | Plus |
chr3R | 26076400..26076486 | 446..532 | 100 | -> | Plus |
chr3R | 26076550..26076624 | 533..607 | 98 | Plus | |
chr3R | 26075711..26075954 | 1..244 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..543 | 11..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..543 | 11..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..543 | 11..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..543 | 11..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..543 | 11..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..607 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..607 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..607 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..607 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18404-RA | 1..607 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30253182..30253425 | 1..244 | 100 | -> | Plus |
3R | 30253485..30253592 | 245..352 | 100 | -> | Plus |
3R | 30253660..30253719 | 353..412 | 100 | -> | Plus |
3R | 30253779..30253811 | 413..445 | 100 | -> | Plus |
3R | 30253873..30253959 | 446..532 | 100 | -> | Plus |
3R | 30254023..30254097 | 533..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30253182..30253425 | 1..244 | 100 | -> | Plus |
3R | 30253485..30253592 | 245..352 | 100 | -> | Plus |
3R | 30253660..30253719 | 353..412 | 100 | -> | Plus |
3R | 30253779..30253811 | 413..445 | 100 | -> | Plus |
3R | 30253873..30253959 | 446..532 | 100 | -> | Plus |
3R | 30254023..30254097 | 533..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30253182..30253425 | 1..244 | 100 | -> | Plus |
3R | 30253485..30253592 | 245..352 | 100 | -> | Plus |
3R | 30253660..30253719 | 353..412 | 100 | -> | Plus |
3R | 30253779..30253811 | 413..445 | 100 | -> | Plus |
3R | 30253873..30253959 | 446..532 | 100 | -> | Plus |
3R | 30254023..30254097 | 533..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26079501..26079533 | 413..445 | 100 | -> | Plus |
arm_3R | 26079595..26079681 | 446..532 | 100 | -> | Plus |
arm_3R | 26079745..26079819 | 533..607 | 100 | Plus | |
arm_3R | 26078904..26079147 | 1..244 | 100 | -> | Plus |
arm_3R | 26079207..26079314 | 245..352 | 100 | -> | Plus |
arm_3R | 26079382..26079441 | 353..412 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29994491..29994550 | 353..412 | 100 | -> | Plus |
3R | 29994610..29994642 | 413..445 | 100 | -> | Plus |
3R | 29994704..29994790 | 446..532 | 100 | -> | Plus |
3R | 29994854..29994928 | 533..607 | 100 | Plus | |
3R | 29994013..29994256 | 1..244 | 100 | -> | Plus |
3R | 29994316..29994423 | 245..352 | 100 | -> | Plus |
Translation from 1 to 552
> GH09039.hyp SNNMQSFTILTLFTIVLMVQNSRAGTLSIGSLMGDVSQVAVAGEKVIHQL ENAVASSQSDFVQPTTLNILSDMGNALGDLANALTSLRVDNDYMQPEATN LLGNVLGGVGTGLGDLANAITSLSVQMTNAPQARSLSSNGASIIAKGGAV SAKTIAAAADAAAPYIKQLNAGLGDLANALTNL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18404-PA | 180 | CG18404-PA | 1..180 | 4..183 | 867 | 100 | Plus |
Translation from 10 to 552
> GH09039.pep MQSFTILTLFTIVLMVQNSRAGTLSIGSLMGDVSQVAVAGEKVIHQLENA VASSQSDFVQPTTLNILSDMGNALGDLANALTSLRVDNDYMQPEATNLLG NVLGGVGTGLGDLANAITSLSVQMTNAPQARSLSSNGASIIAKGGAVSAK TIAAAADAAAPYIKQLNAGLGDLANALTNL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11744-PA | 180 | GG11744-PA | 1..180 | 1..180 | 695 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19157-PA | 177 | GH19157-PA | 1..177 | 1..180 | 466 | 60.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18404-PA | 180 | CG18404-PA | 1..180 | 1..180 | 867 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23262-PA | 182 | GI23262-PA | 5..182 | 6..180 | 412 | 56.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13451-PA | 181 | GL13451-PA | 4..181 | 3..180 | 618 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14921-PB | 181 | GA14921-PB | 4..181 | 3..180 | 631 | 74.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12873-PA | 180 | GM12873-PA | 1..180 | 1..180 | 731 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21512-PA | 180 | GD21512-PA | 1..180 | 1..180 | 757 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10762-PA | 181 | GJ10762-PA | 1..181 | 1..180 | 507 | 57.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14127-PA | 242 | GK14127-PA | 1..184 | 1..180 | 462 | 58.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10870-PA | 180 | GE10870-PA | 1..180 | 1..180 | 712 | 90.6 | Plus |