Clone GH09040 Report

Search the DGRC for GH09040

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:90
Well:40
Vector:pOT2
Associated Gene/TranscriptCG3262-RF
Protein status:GH09040.pep: gold
Preliminary Size:1148
Sequenced Size:920

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3262 2001-01-01 Release 2 assignment
CG3262 2001-12-12 Blastp of sequenced clone
CG3262 2003-01-01 Sim4 clustering to Release 3
CG3262 2008-04-29 Release 5.5 accounting
CG3262 2008-08-15 Release 5.9 accounting
CG3262 2008-12-18 5.12 accounting

Clone Sequence Records

GH09040.complete Sequence

920 bp (920 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070505

> GH09040.complete
ATTGATCAACACGATATGGCGCTCCTACGCAACAAAATTAACTGGGTCCC
AGGTGAAGTTAATGGCGCGGGGATTGCCTAAAAAGCAACCGATTATTGGA
GTACAAGATATTATAGTCGTTGCCTCTGGAAAGGGTGGTGTTGGAAAAAG
CACCGTGGCAGCTTGGCAAAACTAGGAAAGCGAGTAGGATTGCTGGACGG
GGATATCTTCGGGCCTACTATTCCACTTCTCATGAATGTCCATGGTGAGC
CGGTTGTGAACGATAAGAATTTGATGATCCCGCCGCAAAACTACAATGTA
AAGTGCTTGTCTATGGGCATGCTGACACCTGTAGAGACCTCTGTTATCTG
GCGAGGTCCTCTTGTAATGTCAGCAATACAACGACTGCTAAAAGGTACTG
ATTGGGGGCTTCTAGATGTCCTAGTTATAGATACTCCACCGGGCACTGGA
GATGTACATCTCTCACTATCCCAGCATGCACCTATCACAGGGGTTATCCT
GGTAACAACACCTCATACTGCAGCTGTTCAGGTGACCTTGAAAGGTGCAA
GCATGTACGAAAAGTTAAATGTTCCTATCTTTGGCGTAGTAGAGAACATG
AAGTACACCATTTGTCAGAACTGTAATCAACGATTGGAGTTTTTTAAAGA
CAGCCGTATAAGTTCTCTACCGCGCAAGCTAATTTCTCTTCCGTTAGACT
CACGAATAGCGGATAGCAACGAGAGTGGAGTGCCTGTTGTAATAAAATAT
CCGGACAGCAAGTACTCTTATCTATTTACCCAATTGGCTGAGGAGATTAC
ACAAATACTTAACGAACAAAGATGTAATCAAAATCAAAATAACAGTGCAC
ATTAAAAAAAATTTGTGTATATCAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

GH09040.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-RC 1176 CG3262-RC 71..948 1..878 4390 100 Plus
CG3262-RD 1192 CG3262-RD 244..964 158..878 3605 100 Plus
CG3262-RD 1192 CG3262-RD 71..231 1..161 805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22238697..22239412 158..873 3580 100 Plus
chr2L 23010047 chr2L 22238474..22238634 1..161 805 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:39:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22240166..22240886 158..878 3605 100 Plus
2L 23513712 2L 22239943..22240103 1..161 805 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22240166..22240886 158..878 3605 100 Plus
2L 23513712 2L 22239943..22240103 1..161 805 100 Plus
Blast to na_te.dros performed 2019-03-16 05:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 1498..1536 421..383 114 76.9 Minus

GH09040.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:33:41 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22238474..22238634 1..161 100 -> Plus
chr2L 22238701..22239412 162..873 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:29:30 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 12..165 1..154 100 -> Plus
CG3262-RD 178..882 155..855 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:50 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 12..165 1..154 100 -> Plus
CG3262-RD 178..882 155..855 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:12 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 12..165 1..154 100 -> Plus
CG3262-RD 178..882 155..855 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:01 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 12..165 1..154 100 -> Plus
CG3262-RD 178..882 155..855 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:04:41 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RD 12..165 1..154 100 -> Plus
CG3262-RD 178..882 155..855 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:56 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RC 38..910 1..873 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:50 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RC 38..910 1..873 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:12 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RF 28..900 1..873 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:02 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RC 38..910 1..873 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:04:41 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RF 28..900 1..873 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:33:41 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22239943..22240103 1..161 100 -> Plus
2L 22240170..22240881 162..873 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:33:41 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22239943..22240103 1..161 100 -> Plus
2L 22240170..22240881 162..873 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:33:41 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22239943..22240103 1..161 100 -> Plus
2L 22240170..22240881 162..873 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:12 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22239943..22240103 1..161 100 -> Plus
arm_2L 22240170..22240881 162..873 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:47 Download gff for GH09040.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22240170..22240881 162..873 100   Plus
2L 22239943..22240103 1..161 100 -> Plus

GH09040.pep Sequence

Translation from 231 to 854

> GH09040.pep
MNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIWRGPLVMSAIQ
RLLKGTDWGLLDVLVIDTPPGTGDVHLSLSQHAPITGVILVTTPHTAAVQ
VTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKDSRISSLPRKL
ISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEITQILNEQRCNQ
NQNNSAH*

GH09040.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22737-PA 310 GF22737-PA 63..193 1..131 591 77.1 Plus
Dana\GF10354-PA 261 GF10354-PA 75..257 19..192 221 29.9 Plus
Dana\GF20875-PA 310 GF20875-PA 126..284 22..166 208 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21464-PA 294 GG21464-PA 87..292 1..206 984 88.3 Plus
Dere\GG16127-PA 260 GG16127-PA 75..257 19..192 227 31.7 Plus
Dere\GG22765-PA 311 GG22765-PA 127..285 22..166 204 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13628-PA 292 GH13628-PA 86..290 1..202 758 69.3 Plus
Dgri\GH14587-PA 264 GH14587-PA 75..254 19..189 219 29.4 Plus
Dgri\GH11560-PA 311 GH11560-PA 127..286 22..166 195 36.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-PF 207 CG3262-PF 1..207 1..207 1077 100 Plus
CG3262-PE 293 CG3262-PE 87..293 1..207 1077 100 Plus
CG3262-PD 293 CG3262-PD 87..293 1..207 1077 100 Plus
CG17904-PA 311 CG17904-PA 127..285 22..166 229 35.8 Plus
CG4858-PA 260 CG4858-PA 75..258 19..193 224 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11769-PA 297 GI11769-PA 86..291 1..206 746 67.9 Plus
Dmoj\GI13405-PA 264 GI13405-PA 95..254 38..189 207 30.4 Plus
Dmoj\GI17051-PA 310 GI17051-PA 127..285 22..166 184 38.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21144-PA 299 GL21144-PA 93..296 1..203 804 71.1 Plus
Dper\GL12799-PA 255 GL12799-PA 82..254 26..192 198 30.1 Plus
Dper\GL18780-PA 311 GL18780-PA 127..285 22..166 197 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17025-PA 299 GA17025-PA 93..296 1..203 801 71.1 Plus
Dpse\GA18483-PA 258 GA18483-PA 82..257 26..192 222 31.1 Plus
Dpse\GA14715-PA 311 GA14715-PA 127..285 22..166 194 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18803-PA 293 GM18803-PA 87..293 1..207 1060 96.1 Plus
Dsec\GM22307-PA 260 GM22307-PA 75..258 19..193 224 31.5 Plus
Dsec\GM17199-PA 311 GM17199-PA 127..285 22..166 197 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21613-PA 293 GD21613-PA 87..293 1..207 1059 96.1 Plus
Dsim\GD14899-PA 260 GD14899-PA 82..258 26..193 223 32.8 Plus
Dsim\GD24076-PA 311 GD24076-PA 127..285 22..166 191 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13135-PA 298 GJ13135-PA 86..294 1..205 764 67.9 Plus
Dvir\GJ11530-PA 266 GJ11530-PA 95..254 38..189 224 31.2 Plus
Dvir\GJ17301-PA 310 GJ17301-PA 127..285 22..166 191 37.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23989-PA 303 GK23989-PA 94..300 1..207 800 70.7 Plus
Dwil\GK12055-PA 261 GK12055-PA 75..254 19..189 218 29.3 Plus
Dwil\GK24826-PA 310 GK24826-PA 126..284 22..166 195 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12953-PA 293 GE12953-PA 87..293 1..207 985 88.9 Plus
Dyak\GE19695-PA 260 GE19695-PA 75..258 19..193 228 31.5 Plus
Dyak\GE23241-PA 260 GE23241-PA 75..258 19..193 228 31.5 Plus
Dyak\GE12759-PA 311 GE12759-PA 127..285 22..166 195 35.8 Plus

GH09040.hyp Sequence

Translation from 231 to 854

> GH09040.hyp
MNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIWRGPLVMSAIQ
RLLKGTDWGLLDVLVIDTPPGTGDVHLSLSQHAPITGVILVTTPHTAAVQ
VTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKDSRISSLPRKL
ISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEITQILNEQRCNQ
NQNNSAH*

GH09040.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-PF 207 CG3262-PF 1..207 1..207 1077 100 Plus
CG3262-PE 293 CG3262-PE 87..293 1..207 1077 100 Plus
CG3262-PD 293 CG3262-PD 87..293 1..207 1077 100 Plus
CG17904-PA 311 CG17904-PA 127..285 22..166 229 35.8 Plus
CG4858-PA 260 CG4858-PA 75..258 19..193 224 31 Plus