Clone GH09112 Report

Search the DGRC for GH09112

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:91
Well:12
Vector:pOT2
Associated Gene/TranscriptCpr57A-RA
Protein status:GH09112.pep: gold
Preliminary Size:814
Sequenced Size:666

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18066 2001-01-01 Release 2 assignment
CG18066 2001-07-04 Blastp of sequenced clone
CG18066 2003-01-01 Sim4 clustering to Release 3
Cpr57A 2008-04-29 Release 5.5 accounting
Obp57d 2008-08-15 Release 5.9 accounting
Cpr57A 2008-08-15 Release 5.9 accounting
Cpr57A 2008-12-18 5.12 accounting
Obp57d 2008-12-18 5.12 accounting

Clone Sequence Records

GH09112.complete Sequence

666 bp (666 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047580

> GH09112.complete
CAACACAATCCAGCAACCATGTTTATAGTTTTGGTCGTTTGTTTGCTGGC
AGTCGCTGCGGCCGATGTGTCCCATCTGGTCACCCCGGAACCGAAGGTTC
CAGCAAGTCCGTATGTGTTCAGCTACCAAGCTGGCCGTGCTCCCGGCCAT
GTGGATCGCCAGCATACCGAGGTGTCCGATGGATCGGGTGTGATCCGCGG
TGCTTTCTCCTATGTGGACCCAAAGAACCAGGTGCGCACCGTACAGTATG
TGGCGGATGAGCATGGTTTCCATCCTCAGCTTAGCCACAAACTGGAGGAC
AGCGCCGCCGTCCAGGCAGCCAAGCAAAGGCACTTCGCGGCCTACAATCG
GATTGCGCAAGAGCATGCCAACCACACGCCAGGCCAAGTTGCACTAGCAA
ATGCCCCCCATGCCAGCGCCGCCGTTGCACATGCCACCCAGAAGCACCTG
AGCGCCTTCGAGCGGATCGCTGCCGAGCACGCGGCCATTGGACGCCAACA
GGAGGCACAGCGTCTGGCGCTGGCCGCTCAATCTGAGCATGGAGAGATCG
AAGATGGACAGTACCATCCGTAGGTGATGGAGTTCGCTGAATGATGTGAA
AATAAACGGGTAGCTTCCAGAAATAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

GH09112.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr57A-RA 706 Cpr57A-RA 8..632 1..625 3125 100 Plus
Cpr57A-RB 1464 Cpr57A-RB 8..632 1..625 3125 100 Plus
Obp57d-RB 1545 Obp57d-RB 89..713 1..625 3125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16436389..16436747 391..33 1735 98.9 Minus
chr2R 21145070 chr2R 16436086..16436319 624..391 1080 97.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:40:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20549631..20549989 391..33 1795 100 Minus
2R 25286936 2R 20549327..20549561 625..391 1175 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20550830..20551188 391..33 1795 100 Minus
2R 25260384 2R 20550526..20550760 625..391 1175 100 Minus
2R 25260384 2R 20551250..20551284 35..1 175 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:44:04 has no hits.

GH09112.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:44:43 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16436086..16436319 391..624 97 <- Minus
chr2R 16436390..16436746 34..390 98 <- Minus
chr2R 16436811..16436843 1..33 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:29:50 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr57A-RB 1..555 19..573 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:28:40 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr57A-RB 1..555 19..573 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:46 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr57A-RA 1..555 19..573 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:02 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr57A-RB 1..555 19..573 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:30 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr57A-RA 1..555 19..573 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:28:46 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57d-RB 8..631 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:28:40 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57d-RB 8..631 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:46 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr57A-RA 33..656 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:02 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57d-RB 8..631 1..624 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:30 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr57A-RA 33..656 1..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:43 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20549328..20549561 391..624 100 <- Minus
2R 20549632..20549988 34..390 100 <- Minus
2R 20550053..20550085 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:43 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20549328..20549561 391..624 100 <- Minus
2R 20549632..20549988 34..390 100 <- Minus
2R 20550053..20550085 1..33 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:43 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20549328..20549561 391..624 100 <- Minus
2R 20549632..20549988 34..390 100 <- Minus
2R 20550053..20550085 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:46 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16436833..16437066 391..624 100 <- Minus
arm_2R 16437137..16437493 34..390 100 <- Minus
arm_2R 16437558..16437590 1..33 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:39:59 Download gff for GH09112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20550527..20550760 391..624 100 <- Minus
2R 20550831..20551187 34..390 100 <- Minus
2R 20551252..20551284 1..33 100   Minus

GH09112.hyp Sequence

Translation from 1 to 572

> GH09112.hyp
QHNPATMFIVLVVCLLAVAAADVSHLVTPEPKVPASPYVFSYQAGRAPGH
VDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLSHKLED
SAAVQAAKQRHFAAYNRIAQEHANHTPGQVALANAPHASAAVAHATQKHL
SAFERIAAEHAAIGRQQEAQRLALAAQSEHGEIEDGQYHP*

GH09112.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr57A-PB 184 CG18066-PB 1..184 7..190 949 100 Plus
Cpr57A-PA 184 CG18066-PA 1..184 7..190 949 100 Plus

GH09112.pep Sequence

Translation from 18 to 572

> GH09112.pep
MFIVLVVCLLAVAAADVSHLVTPEPKVPASPYVFSYQAGRAPGHVDRQHT
EVSDGSGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLSHKLEDSAAVQA
AKQRHFAAYNRIAQEHANHTPGQVALANAPHASAAVAHATQKHLSAFERI
AAEHAAIGRQQEAQRLALAAQSEHGEIEDGQYHP*

GH09112.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12663-PA 188 GF12663-PA 4..186 2..184 890 92.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20854-PA 186 GG20854-PA 4..186 2..184 921 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21063-PA 192 GH21063-PA 4..192 2..184 720 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr57A-PB 184 CG18066-PB 1..184 1..184 949 100 Plus
Cpr57A-PA 184 CG18066-PA 1..184 1..184 949 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18665-PA 197 GI18665-PA 11..197 1..184 770 79.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16807-PA 191 GL16807-PA 6..191 1..184 740 84.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14778-PA 191 GA14778-PA 6..191 1..184 737 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19781-PA 186 GM19781-PA 4..186 2..184 938 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25273-PA 186 GD25273-PA 4..186 2..184 936 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21682-PA 189 GJ21682-PA 4..189 2..184 801 82.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20990-PA 183 GK20990-PA 1..183 6..184 789 85.8 Plus
Dwil\GK20986-PA 183 GK20986-PA 1..183 6..184 789 85.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13794-PA 186 GE13794-PA 4..186 2..184 907 96.2 Plus